Primary Antibodies

View as table Download

Rabbit Polyclonal Glucose 6 phosphate isomerase Antibody

Applications ELISA
Reactivities Human
Conjugation Unconjugated
Immunogen DNA immunization. This antibody is specific for the N Terminus Region of the target protein.

Glucose 6 phosphate isomerase (GPI) (C-term) rabbit polyclonal antibody, Aff - Purified

Applications FC, WB
Reactivities Human, Mouse
Immunogen KLH conjugated synthetic peptide between 452~481 amino acids from the C-terminal region of human GPI

Rabbit Polyclonal Anti-GPI Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-GPI antibody: synthetic peptide directed towards the C terminal of human GPI. Synthetic peptide located within the following region: SFDQWGVELGKQLAKKIEPELDGSAQVTSHDASTNGLINFIKQQREARVQ

Rabbit Polyclonal Anti-GPI Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-GPI antibody: synthetic peptide directed towards the C terminal of human GPI. Synthetic peptide located within the following region: EALMRGKSTEEARKELQAAGKSPEDLERLLPHKVFEGNRPTNSIVFTKLT

Carrier-free (BSA/glycerol-free) GPI mouse monoclonal antibody, clone OTI5G9 (formerly 5G9)

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) GPI mouse monoclonal antibody, clone OTI4B11 (formerly 4B11)

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) GPI mouse monoclonal antibody, clone OTI8G7 (formerly 8G7)

Applications FC, IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) GPI mouse monoclonal antibody, clone OTI7G10 (formerly 7G10)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) GPI mouse monoclonal antibody, clone OTI5A11 (formerly 5A11)

Applications FC, IF, IHC, WB
Reactivities Human, Monkey, Mouse, Rat, Dog
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) GPI mouse monoclonal antibody, clone OTI2D2 (formerly 2D2)

Applications IF, IHC, WB
Reactivities Human, Monkey, Mouse, Rat
Conjugation Unconjugated

GPI rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human GPI

glucose-6-phosphate isomerase Rabbit polyclonal Antibody

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-280 of human glucose-6-phosphate isomerase (NP_000166.2).
Modifications Unmodified

glucose-6-phosphate isomerase Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-280 of human glucose-6-phosphate isomerase (NP_000166.2).
Modifications Unmodified

Anti-GPI (Glucose 6 phosphate isomerase) mouse monoclonal antibody, clone OTI5G9 (formerly 5G9)

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Special Offer: Get a 15% discount on this product. Use code: "KO15".

Anti-GPI (Glucose 6 phosphate isomerase) mouse monoclonal antibody, clone OTI5G9 (formerly 5G9), Biotinylated

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Biotin

Anti-GPI (Glucose 6 phosphate isomerase) mouse monoclonal antibody, clone OTI5G9 (formerly 5G9), HRP conjugated

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation HRP

Anti-GPI (Glucose 6 phosphate isomerase) mouse monoclonal antibody, clone OTI5G9 (formerly 5G9)

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Anti-GPI (Glucose 6 phosphate isomerase) mouse monoclonal antibody, clone OTI4B11 (formerly 4B11)

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Special Offer: Get a 15% discount on this product. Use code: "KO15".

Anti-GPI (Glucose 6 phosphate isomerase) mouse monoclonal antibody, clone OTI4B11 (formerly 4B11), Biotinylated

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Biotin

Anti-GPI (Glucose 6 phosphate isomerase) mouse monoclonal antibody, clone OTI4B11 (formerly 4B11), HRP conjugated

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation HRP

Anti-GPI (Glucose 6 phosphate isomerase) mouse monoclonal antibody, clone OTI4B11 (formerly 4B11)

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Anti-GPI (Glucose 6 phosphate isomerase) mouse monoclonal antibody, clone OTI8G7 (formerly 8G7)

Applications FC, IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Special Offer: Get a 15% discount on this product. Use code: "KO15".

Anti-GPI (Glucose 6 phosphate isomerase) mouse monoclonal antibody, clone OTI8G7 (formerly 8G7), Biotinylated

Applications FC, IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Biotin

Anti-GPI (Glucose 6 phosphate isomerase) mouse monoclonal antibody, clone OTI8G7 (formerly 8G7), HRP conjugated

Applications FC, IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation HRP

Anti-GPI (Glucose 6 phosphate isomerase) mouse monoclonal antibody, clone OTI8G7 (formerly 8G7)

Applications FC, IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Anti-GPI (Glucose 6 phosphate isomerase) mouse monoclonal antibody, clone OTI7G10 (formerly 7G10)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Special Offer: Get a 15% discount on this product. Use code: "KO15".

Anti-GPI (Glucose 6 phosphate isomerase) mouse monoclonal antibody, clone OTI7G10 (formerly 7G10), Biotinylated

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Biotin

Anti-GPI (Glucose 6 phosphate isomerase) mouse monoclonal antibody, clone OTI7G10 (formerly 7G10), HRP conjugated

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation HRP

Anti-GPI (Glucose 6 phosphate isomerase) mouse monoclonal antibody, clone OTI7G10 (formerly 7G10)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Anti-GPI (Glucose 6 phosphate isomerase) mouse monoclonal antibody, clone OTI5A11 (formerly 5A11)

Applications FC, IF, IHC, WB
Reactivities Human, Monkey, Mouse, Rat, Dog
Conjugation Unconjugated

Special Offer: Get a 15% discount on this product. Use code: "KO15".

Anti-GPI (Glucose 6 phosphate isomerase) mouse monoclonal antibody, clone OTI5A11 (formerly 5A11), Biotinylated

Applications FC, IF, IHC, WB
Reactivities Human, Monkey, Mouse, Rat, Dog
Conjugation Biotin

Anti-GPI (Glucose 6 phosphate isomerase) mouse monoclonal antibody, clone OTI5A11 (formerly 5A11), HRP conjugated

Applications FC, IF, IHC, WB
Reactivities Human, Monkey, Mouse, Rat, Dog
Conjugation HRP

Anti-GPI (Glucose 6 phosphate isomerase) mouse monoclonal antibody, clone OTI5A11 (formerly 5A11)

Applications FC, IF, IHC, WB
Reactivities Human, Monkey, Mouse, Rat, Dog
Conjugation Unconjugated

Anti-GPI (Glucose 6 phosphate isomerase) mouse monoclonal antibody, clone OTI2D2 (formerly 2D2)

Applications IF, IHC, WB
Reactivities Human, Monkey, Mouse, Rat
Conjugation Unconjugated

Special Offer: Get a 15% discount on this product. Use code: "KO15".

Anti-GPI (Glucose 6 phosphate isomerase) mouse monoclonal antibody, clone OTI2D2 (formerly 2D2), Biotinylated

Applications IF, IHC, WB
Reactivities Human, Monkey, Mouse, Rat
Conjugation Biotin

Anti-GPI (Glucose 6 phosphate isomerase) mouse monoclonal antibody, clone OTI2D2 (formerly 2D2), HRP conjugated

Applications IF, IHC, WB
Reactivities Human, Monkey, Mouse, Rat
Conjugation HRP

Anti-GPI (Glucose 6 phosphate isomerase) mouse monoclonal antibody, clone OTI2D2 (formerly 2D2)

Applications IF, IHC, WB
Reactivities Human, Monkey, Mouse, Rat
Conjugation Unconjugated