Primary Antibodies

View as table Download

Rabbit Polyclonal Anti-KCTD18 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-KCTD18 antibody: synthetic peptide directed towards the N terminal of human KCTD18. Synthetic peptide located within the following region: LHYLNTSGASCESRIIGVYATKTDGTDAIEKQLGGRIHSKGIFKREAGNN

KCTD18 rabbit polyclonal antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Fusion protein of human KCTD18

KCTD18 rabbit polyclonal antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Fusion protein of human KCTD18