Rabbit Polyclonal EIG121 Antibody
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | EIG121 antibody was raised against an 18 amino acid synthetic peptide near the carboxy terminus of human EIG121. |
Rabbit Polyclonal EIG121 Antibody
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | EIG121 antibody was raised against an 18 amino acid synthetic peptide near the carboxy terminus of human EIG121. |
USD 450.00
2 Weeks
Estrogen induced gene 121 protein (KIAA1324) (C-term) rabbit polyclonal antibody, Aff - Purified
Applications | IHC, WB |
Reactivities | Human, Mouse |
Immunogen | KLH conjugated synthetic peptide between 703-732 amino acids from the C-terminal region of Human KIAA1324 / EIG121 |
KIAA1324 / maba1 Rabbit Polyclonal (Internal) Antibody
Applications | IHC |
Reactivities | Gibbon, Chimpanzee, Gorilla, Human, Orang-Utan |
Conjugation | Unconjugated |
Immunogen | KIAA1324 / maba1 antibody was raised against synthetic 17 amino acid peptide from internal region of human KIAA1324. Percent identity with other species by BLAST analysis: Human, Chimpanzee, Gorilla, Orangutan, Gibbon, Monkey (100%); Marmoset, Elephant (94%); Galago, Panda, Dog, Horse, Opossum, Platypus (88%); Mouse, Rat, Hamster, Bat, Bovine, Pig, Lizard (82%). |
Rabbit Polyclonal Anti-KIAA1324 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-KIAA1324 antibody: synthetic peptide directed towards the N terminal of human KIAA1324. Synthetic peptide located within the following region: PCAEGRYSLGTGIRFDEWDELPHGFASLSANMELDDSAAESTGNCTSSKW |
USD 345.00
In Stock
Rabbit Polyclonal Anti-KIAA1324 Antibody
Applications | IHC |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human KIAA1324 |
KIAA1324 rabbit polyclonal antibody
Applications | IHC |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human KIAA1324 |
KIAA1324 Rabbit polyclonal Antibody
Applications | WB |
Reactivities | Mouse |
Conjugation | Unconjugated |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 42-300 of human KIAA1324 (NP_001253977.1). |
Modifications | Unmodified |