Primary Antibodies

View as table Download

Rabbit Polyclonal EIG121 Antibody

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen EIG121 antibody was raised against an 18 amino acid synthetic peptide near the carboxy terminus of human EIG121.

Estrogen induced gene 121 protein (KIAA1324) (C-term) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human, Mouse
Immunogen KLH conjugated synthetic peptide between 703-732 amino acids from the C-terminal region of Human KIAA1324 / EIG121

KIAA1324 / maba1 Rabbit Polyclonal (Internal) Antibody

Applications IHC
Reactivities Gibbon, Chimpanzee, Gorilla, Human, Orang-Utan
Conjugation Unconjugated
Immunogen KIAA1324 / maba1 antibody was raised against synthetic 17 amino acid peptide from internal region of human KIAA1324. Percent identity with other species by BLAST analysis: Human, Chimpanzee, Gorilla, Orangutan, Gibbon, Monkey (100%); Marmoset, Elephant (94%); Galago, Panda, Dog, Horse, Opossum, Platypus (88%); Mouse, Rat, Hamster, Bat, Bovine, Pig, Lizard (82%).

Rabbit Polyclonal Anti-KIAA1324 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-KIAA1324 antibody: synthetic peptide directed towards the N terminal of human KIAA1324. Synthetic peptide located within the following region: PCAEGRYSLGTGIRFDEWDELPHGFASLSANMELDDSAAESTGNCTSSKW

Rabbit Polyclonal Anti-KIAA1324 Antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein of human KIAA1324

KIAA1324 rabbit polyclonal antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein of human KIAA1324

KIAA1324 Rabbit polyclonal Antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 42-300 of human KIAA1324 (NP_001253977.1).
Modifications Unmodified