Primary Antibodies

View as table Download

Rabbit Polyclonal Anti-Loxl2 Antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-Loxl2 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: NNGQSDFRPKNGRHAWIWHDCHRHYHSMEVFTYYDLLSLNGTKVAEGHKA

LOXL2 (C-term) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 588-617 amino acids from the C-terminal region of Human LOXL2

Rabbit Polyclonal Anti-LOXL2 Antibody (N-Terminus)

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen LOXL2 antibody was raised against synthetic 15 amino acid peptide from N-terminus of human LOXL2. Percent identity with other species by BLAST analysis: Human, Gorilla, Orangutan, Monkey, Marmoset, Dog, Bovine, Bat, Elephant, Panda, Horse, Rabbit (100%); Mouse, Rat, Opossum, Turkey, Chicken, Platypus (93%); Xenopus, Pufferfish, Zebrafish, Stickleback (87%).

Rabbit Polyclonal Anti-LOXL2 Antibody (Internal)

Applications IHC
Reactivities Human
Immunogen LOXL2 antibody was raised against synthetic 17 amino acid peptide from internal region of human LOXL2. Percent identity with other species by BLAST analysis: Human, Marmoset (100%); Gorilla, Orangutan, Monkey, Bovine, Bat, Elephant (94%); Dog, Panda, Horse, Opossum (88%); Mouse, Rat, Turkey, Chicken, Platypus (82%).

Rabbit Polyclonal Anti-LOXL2 Antibody (Internal)

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen LOXL2 antibody was raised against synthetic 20 amino acid peptide from internal region of human LOXL2. Percent identity with other species by BLAST analysis: Human, Gorilla, Orangutan, Monkey, Galago, Marmoset, Mouse, Rat, Elephant, Panda, Dog, Bovine, Horse, Rabbit, Guinea pig (100%); Bat (95%).

Carrier-free (BSA/glycerol-free) LOXL2 mouse monoclonal antibody, clone OTI8B2 (formerly 8B2)

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) LOXL2 mouse monoclonal antibody, clone OTI2A7 (formerly 2A7)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) LOXL2 mouse monoclonal antibody, clone OTI8G5 (formerly 8G5)

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) LOXL2 mouse monoclonal antibody, clone OTI4H3 (formerly 4H3)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Rabbit Polyclonal Anti-LOXL2 rabbit polyclonal antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human LOXL2

LOXL2 Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 505-774 of human LOXL2 (NP_002309.1).
Modifications Unmodified

LOXL2 Rabbit monoclonal Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated

LOXL2 mouse monoclonal antibody, clone OTI8B2 (formerly 8B2)

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

LOXL2 mouse monoclonal antibody, clone OTI8B2 (formerly 8B2)

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

LOXL2 mouse monoclonal antibody, clone OTI2A7 (formerly 2A7)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

LOXL2 mouse monoclonal antibody, clone OTI8G5 (formerly 8G5)

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

LOXL2 mouse monoclonal antibody, clone OTI8G5 (formerly 8G5), Biotinylated

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Biotin

LOXL2 mouse monoclonal antibody, clone OTI8G5 (formerly 8G5), HRP conjugated

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation HRP

LOXL2 mouse monoclonal antibody, clone OTI8G5 (formerly 8G5)

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

LOXL2 mouse monoclonal antibody, clone OTI4H3 (formerly 4H3)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated