Primary Antibodies

View as table Download

MAFA rabbit polyclonal antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide of human MAFA

MAFA (Center) rabbit polyclonal antibody, Purified

Applications WB
Reactivities Human, Mouse
Immunogen KLH conjugated synthetic peptide between 209~238 amino acids from the Central region of Human MAFA.

MAFA (C-term) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 285-315 amino acids from the C-terminal region of human MAFA

MAFA (C-term) rabbit polyclonal antibody, Purified

Applications WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 288~318 amino acids from the C-terminal region of human MAFA

Rabbit polyclonal Anti-Mafa Antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-Mafa antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: KLEVGRLAKERDLYKEKYEKLAGRGGPGGAGGAGFPREPSPAQAGPGAAK

Rabbit polyclonal Anti-Mafa Antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-Mafa antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: GGGSAAQAGGAPGPPSGGPGTVGGASGKAVLEDLYWMSGYQHHLNPEALN

Rabbit Polyclonal Anti-MAFA Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-MAFA antibody: synthetic peptide directed towards the N terminal of human MAFA. Synthetic peptide located within the following region: KPALEDLYWMSGYQHHLNPEALNLTPEDAVEALIGSGHHGAHHGAHHPAA

Rabbit Polyclonal Anti-MAFA Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-MAFA antibody: synthetic peptide directed towards the N terminal of human MAFA. Synthetic peptide located within the following region: PSPGTGGGGGAGGGGGSSQAGGAPGPPSGGPGAVGGTSGKPALEDLYWMS

MAFA rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human MAFA