Primary Antibodies

View as table Download

Rabbit Polyclonal Anti-MYH9 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-MYH9 antibody: synthetic peptide directed towards the middle region of human MYH9. Synthetic peptide located within the following region: DAMNREVSSLKNKLRRGDLPFVVPRRMARKGAGDGSDEEVDGKADGAEAK

Lymphotactin (XCL1) (22-114) mouse monoclonal antibody, clone 1E1, Purified

Applications ELISA, IHC, WB
Reactivities Human

MYH9 Rabbit polyclonal Antibody

Applications IHC, IP, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1711-1960 of human MYH9 (NP_002464.1).
Modifications Unmodified

MYH9 Rabbit polyclonal Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1711-1960 of human MYH9 (NP_002464.1).

Phospho-MYH9-S1943 Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthetic phosphorylated peptide around S1943 of human MYH9 (NP_002464.1).
Modifications Phospho S1943