Primary Antibodies

View as table Download

Rabbit polyclonal anti-NDUFA3 antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human NDUFA3.

Rabbit Polyclonal Anti-NDUFA3 Antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-Ndufa3 antibody is: synthetic peptide directed towards the C-terminal region of Mouse Ndufa3. Synthetic peptide located within the following region: ISPYTKYASMINKATPYNYPVPVRDDGNMPDVPSHPQDPLGPSLDWLKNL

Rabbit Polyclonal Anti-NDUFA3 Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein of human NDUFA3

NDUFA3 rabbit polyclonal antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein of human NDUFA3