USD 399.00
In Stock
NFKBIZ mouse monoclonal antibody, clone 1E8, PE conjugated
Applications | FC, WB |
Reactivities | Human, Rat |
Conjugation | PE |
USD 399.00
In Stock
NFKBIZ mouse monoclonal antibody, clone 1E8, PE conjugated
Applications | FC, WB |
Reactivities | Human, Rat |
Conjugation | PE |
Rabbit Polyclonal IKB zeta Antibody
Applications | WB |
Reactivities | Mouse |
Conjugation | Unconjugated |
Immunogen | Synthetic peptides corresponding to an amino acid range between 270-320 and 670-720 of mouse IkB zeta protein were used as the immunogen for this antibody. |
Rabbit Polyclonal Anti-Nfkbiz Antibody - C-terminal region
Applications | WB |
Reactivities | Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-Nfkbiz antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: VRLLMRKGADPSTRNLENEQPVHLVPDGPVGEQIRRILKGKSIQQRAPPY |
NFKBIZ rabbit polyclonal antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human NFKBIZ |
Carrier-free (BSA/glycerol-free) NFKBIZ mouse monoclonal antibody, clone OTI1E8 (formerly 1E8)
Applications | FC, WB |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
NFKBIZ Antibody - C-terminal region
Applications | WB |
Conjugation | Unconjugated |
Immunogen | The immunogen is a synthetic peptide directed towards the C terminal region of mouse NFKBIZ |
NFKBIZ rabbit polyclonal antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human NFKBIZ |
NFKBIZ Rabbit polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-220 of human NFKBIZ (NP_113607.1). |
Modifications | Unmodified |
NFKBIZ mouse monoclonal antibody, clone OTI1E8 (formerly 1E8)
Applications | FC, WB |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
USD 420.00
5 Days
NFKBIZ mouse monoclonal antibody, clone 1E8, Biotinylated
Applications | FC, WB |
Reactivities | Human, Rat |
Conjugation | Biotin |
USD 420.00
5 Days
NFKBIZ mouse monoclonal antibody, clone 1E8, HRP conjugated
Applications | FC, WB |
Reactivities | Human, Rat |
Conjugation | HRP |
NFKBIZ mouse monoclonal antibody, clone OTI1E8 (formerly 1E8)
Applications | FC, WB |
Reactivities | Human, Rat |
Conjugation | Unconjugated |