Primary Antibodies

View as table Download

Rabbit Polyclonal Anti-PIAS1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PIAS1 antibody: synthetic peptide directed towards the middle region of human PIAS1. Synthetic peptide located within the following region: LPTTNGSSSGSNSSLVSSNSLRESHSHTVTNRSSTDTASIFGIIPDIISL

Rabbit polyclonal PIAS1 antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from Internal of human PIAS1.

Rabbit Polyclonal Anti-PIAS1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PIAS1 antibody: synthetic peptide directed towards the N terminal of human PIAS1. Synthetic peptide located within the following region: MADSAELKQMVMSLRVSELQVLLGYAGRNKHGRKHELLTKALHLLKAGCS

Rabbit Polyclonal Anti-PIAS1 Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-PIAS1 Antibody: A synthesized peptide derived from human PIAS1

PIAS1 (C-term) rabbit polyclonal antibody

Applications ELISA, IHC, WB
Reactivities Human, Mouse, Rat
Immunogen PIAS1 antibody was raised against synthetic peptide - KLH conjugated

Rabbit Polyclonal PIAS1 Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen PIAS1 antibody was raised against a 15 amino acid synthetic peptide near the carboxy terminus of human PIAS1.

Rabbit Polyclonal Antibody against PIAS1 (N-term)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This PIAS1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 100-130 amino acids from the N-terminal region of human PIAS1.

Rabbit Polyclonal Antibody against PIAS1 (C-term)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This PIAS1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 607-637 amino acids from the C-terminal region of human PIAS1.

Rabbit Polyclonal Anti-PIAS1 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human PIAS1

PIAS1 Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 422-651 of human PIAS1 (NP_057250.1).
Modifications Unmodified

PIAS1/2 Rabbit polyclonal Antibody

Applications FC, IF, IHC, IP, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthesized peptide derived from human PIAS1