Primary Antibodies

View as table Download

Rabbit Polyclonal TRPV4 Antibody

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen TRPV4 antibody was raised against an 18 amino acid peptide near the center of human TRPV4. The immunogen is located within amino acids 380 - 430 of TRPV4.

Rabbit Polyclonal Anti-TRPV4 (extracellular)

Applications IF, IHC, WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen Peptide (C)EDQSN(S)TVPSYPA(S)RD, corresponding to amino acid residues 647-662 of rat TRPV4. 3rd extracellular loop.

Rabbit Polyclonal Anti-TRPV4

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Peptide CDGHQQGYAPKWRAEDAPL, corresponding to amino acid residues 853-871 of rat TRPV4. Intracellular, C-terminus.

Rabbit Polyclonal Anti-TRPV4 Antibody

Applications IHC, WB
Reactivities Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-TRPV4 antibody: synthetic peptide directed towards the middle region of human TRPV4. Synthetic peptide located within the following region: RVDEVNWSHWNQNLGIINEDPGKNETYQYYGFSHTVGRLRRDRWSSVVPR

TRPV4 Rabbit Polyclonal (Internal) Antibody

Applications IHC
Reactivities Gibbon, Bovine, Dog, Gorilla, Hamster, Horse, Human, Monkey, Mouse, Pig, Rat
Conjugation Unconjugated
Immunogen TRPV4 antibody was raised against synthetic 20 amino acid peptide from internal region of human TRPV4. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Marmoset, Mouse, Rat, Hamster, Panda, Bovine, Dog, Horse, Pig (100%); Elephant, Rabbit (95%); Turkey, Chicken, Platypus (90%); Xenopus (85%); Stickleback, Zebrafish (80%).

TRPV4 Rabbit Polyclonal (N-Terminus) Antibody

Applications IHC
Reactivities Human
Immunogen TRPV4 antibody was raised against synthetic 18 amino acid peptide from N-terminus of human TRPV4. Percent identity with other species by BLAST analysis: Human (100%); Marmoset (94%); Panda, Dog (89%); Hamster, Bovine, Pig (83%).

Anti-TRPV4 Rabbit Polyclonal Antibody

Applications ELISA, IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 237-465 amino acids of human transient receptor potential cation channel, subfamily V, member 4

Anti-TRPV4 Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 237-465 amino acids of human transient receptor potential cation channel, subfamily V, member 4

TRPV4 Antibody - N-terminal region

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the N-terminal region of human TRPV4

TrpV4 Rabbit polyclonal Antibody

Applications ELISA, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from human TRPV4. AA range:417-466