Primary Antibodies

View as table Download

Rabbit Polyclonal Anti-ZFP42 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ZFP42 antibody: synthetic peptide directed towards the middle region of human ZFP42. Synthetic peptide located within the following region: FNLRTHVRIHTGEKRFVCPFQGCNRRFIQSNNLKAHILTHANTNKNEQEG

Rabbit Polyclonal Anti-Rex1(ZFP42) Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-Rex1(ZFP42) Antibody: Peptide sequence around aa.10~14(K-T-R-H-Q) derived from Human Rex1(ZFP42).

ZFP42 rabbit polyclonal antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide of human ZFP42

Rabbit Polyclonal Anti-ZFP42 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ZFP42 antibody: synthetic peptide directed towards the N terminal of human ZFP42. Synthetic peptide located within the following region: MSQQLKKRAKTRHQKGLGGRAPSGAKPRQGKSSQDLQAEIEPVSAVWALC

Rabbit Polyclonal Anti-ZFP42 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ZFP42 antibody: synthetic peptide directed towards the middle region of human ZFP42. Synthetic peptide located within the following region: QKVFEASSLECSLEYMKKGVKKELPQKIVGENSLEYSEYMTGKKLPPGGI

Carrier-free (BSA/glycerol-free) ZFP42 mouse monoclonal antibody, clone OTI3H9 (formerly 3H9)

Applications WB
Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) ZFP42 mouse monoclonal antibody, clone OTI9E8 (formerly 9E8)

Applications WB
Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) ZFP42 mouse monoclonal antibody, clone OTI12A7 (formerly 12A7)

Applications WB
Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) ZFP42 mouse monoclonal antibody, clone OTI3B2 (formerly 3B2)

Applications WB
Reactivities Human
Conjugation Unconjugated

Rabbit Polyclonal Anti-ZFP42 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide of human ZFP42

ZFP42 Rabbit polyclonal Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-140 of human ZFP42 (NP_777560.2).
Modifications Unmodified

ZFP42 mouse monoclonal antibody, clone OTI3H9 (formerly 3H9)

Applications WB
Reactivities Human
Conjugation Unconjugated

ZFP42 mouse monoclonal antibody, clone OTI3H9 (formerly 3H9)

Applications WB
Reactivities Human
Conjugation Unconjugated

ZFP42 mouse monoclonal antibody, clone OTI9E8 (formerly 9E8)

Applications WB
Reactivities Human
Conjugation Unconjugated

ZFP42 mouse monoclonal antibody, clone OTI9E8 (formerly 9E8)

Applications WB
Reactivities Human
Conjugation Unconjugated

ZFP42 mouse monoclonal antibody, clone OTI12A7 (formerly 12A7)

Applications WB
Reactivities Human
Conjugation Unconjugated

ZFP42 mouse monoclonal antibody, clone OTI12A7 (formerly 12A7)

Applications WB
Reactivities Human
Conjugation Unconjugated

ZFP42 mouse monoclonal antibody, clone OTI3B2 (formerly 3B2)

Applications WB
Reactivities Human
Conjugation Unconjugated

ZFP42 mouse monoclonal antibody, clone OTI3B2 (formerly 3B2)

Applications WB
Reactivities Human
Conjugation Unconjugated