Antibodies

View as table Download

Rabbit Polyclonal Anti-PAK2 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human PAK2

Rabbit Polyclonal Anti-ITGB1 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human ITGB1

Rabbit Polyclonal PAK2 Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen PAK2 antibody was raised against a 14 amino acid peptide from near the amino terminus of human PAK2.

Rabbit Polyclonal Anti-NFATC3 Antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein of human NFATC3

Rabbit Polyclonal Anti-PAK6 Antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein of human PAK6

Rabbit Polyclonal antibody to RAC1 (ras-related C3 botulinum toxin substrate 1 (rho family, small GTP binding protein Rac1))

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant fragment contain a sequence corresponding to a region within amino acids 1 and 196 of RAC1 (Uniprot ID#P63000 isoform B)

Rabbit Polyclonal CXCR4 Antibody

Applications FC, IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen CXCR4 antibody was raised against a peptide corresponding to 14 amino acids near the amino terminus of human CXCR4. The immunogen is located within the first 50 amino acids of CXCR4.

Rabbit polyclonal CDK5 (Ab-15) antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized non-phosphopeptide derived from human CDK5 around the phosphorylation site of tyrosine 15 (G-T-YP-G-T)

NFATC1 Rabbit Polyclonal Antibody

Applications ICC/IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human NFATC1

Rabbit Polyclonal Anti-NFATC2 Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-NFATC2 antibody: synthetic peptide directed towards the C terminal of human NFATC2. Synthetic peptide located within the following region: PTVIQQQNATSQRAAKNGPPVSDQKEVLPAGVTIKQEQNLDQTYLDDVNE

Rabbit Polyclonal Anti-SLIT1 Antibody - middle region

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-SLIT1 antibody: synthetic peptide directed towards the middle region of human SLIT1. Synthetic peptide located within the following region: GAHCVCDPGFSGELCEQESECRGDPVRDFHQVQRGYAICQTTRPLSWVEC

Rabbit polyclonal anti-EPHB6 antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human EPHB6.

Rabbit Polyclonal NRAS Antibody

Applications ELISA, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen DNA immunization. This antibody is specific for the C Terminus Region of the target protein.

Rabbit Polyclonal ROCK2 Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen ROCK2 antibody was raised against a 15 amino acid synthetic peptide near the center of human ROCK2.

Rabbit polyclonal p44/42 MAPK antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from human ERK1/2.

Rabbit anti-CDC42 Polyclonal Antibody

Applications ICC/IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human CDC42

Rabbit anti-ROCK2 Polyclonal Antibody

Applications ICC/IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human ROCK2

Rabbit Polyclonal Anti-ABL1 Antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein of human ABL1

Rabbit Polyclonal LIM kinase 2 Antibody

Applications ELISA, IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen DNA immunization. This antibody is specific for the Middle Region of the target protein.

Rabbit polyclonal antibody to ROCK1 (Rho-associated, coiled-coil containing protein kinase 1)

Applications IF, IHC, IP, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant protein fragment contain a sequence corresponding to a region within amino acids 107 and 371 of ROCK1

Rabbit polyclonal anti-EFNA5 antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human EFNA5.

Rabbit polyclonal anti-LIMK2 antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human LIMK2.

Rabbit Polyclonal Anti-CXCR4 (extracellular)

Applications FC, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Peptide (C)EGISIYTSDNYTEE,corresponding to amino acid residues 2-15 of human CXCR4. Extracellular, N-terminus.

Rabbit anti-EFNA1 Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant protein of human EFNA1

Rabbit polyclonal NFAT3 (Ab-676) antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized non-phosphopeptide derived from human NFAT3 around the phosphorylation site of serine 676 (K-R-SP-P-T).

Rabbit polyclonal anti-Ephrin-B3 antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from human Ephrin-B3.

Rabbit polyclonal c-Met (Tyr1003) antibody(Phospho-specific)

Applications IF, IHC, WB
Reactivities Human: Tyr1003, Mouse: Tyr1001, Rat: Tyr1004
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from human c-Met around the phosphorylation site of tyrosine 1003 (V-D-YP-R-A).
Modifications Phospho-specific

Rabbit polyclonal Integrin beta1 (Thr789) antibody(Phospho-specific)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from human Integrin β1 around the phosphorylation site of threonine 789 (V-T-TP-V-V).
Modifications Phospho-specific

Rabbit polyclonal FAK (Ab-843) antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from Internal of human FAK.

Rabbit polyclonal anti-PAK7 antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from C-terminal of human PAK7.

Rabbit polyclonal CRMP-2 (Ab-509) antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized non-phosphopeptide derived from human CRMP-2 around the phosphorylation site of threonine 509 (S-V-TP-P-K).

Rabbit polyclonal DRP-2 (Ab-514) antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized non-phosphopeptide derived from human DRP-2 around the phosphorylation site of threonine 514 (T-V-TP-P-A).

Rabbit polyclonal Ephrin B1/B2/B3 (Tyr324) antibody(Phospho-specific)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from human Ephrin B1/B2/B3 around the phosphorylation site of tyrosine 324 (G-D-YP-G-H).
Modifications Phospho-specific

Rabbit polyclonal anti-EPHB1/2/3 antibody

Applications IF, IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human EPHB1/2/3.

GSK3B / GSK3 Beta Rabbit Polyclonal (pSer9) Antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen GSK3B / GSK3 Beta antibody was raised against synthetic peptide from human GSK3B / GSK3 Beta.

Anti-PAK1 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 225-238 amino acids of Human p21 protein (Cdc42/Rac)-activated kinase

Rabbit polyclonal EFNB2 Antibody (Center)

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This EFNB2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 157-186 amino acids from the Central region of human EFNB2.

Rabbit polyclonal PAK1 (Ab-204) antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized non-phosphopeptide derived from human PAK1 around the phosphorylation site of serine 204 (T-R-SP-V-I).

Rabbit polyclonal PAK1 (Phospho-Ser199) antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from human PAK1/2 around the phosphorylation site of serine 199 (T-K-SP-V-Y).
Modifications Phospho-specific

Rabbit polyclonal PAK1 (Phospho-Ser204) antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from human PAK1 around the phosphorylation site of serine 204 (T-R-SP-V-I).
Modifications Phospho-specific

Rabbit polyclonal PAK1/2 (Ab-199) antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized non-phosphopeptide derived from human PAK1/2 around the phosphorylation site of serine 199 (T-K-SP-V-Y).

Rabbit polyclonal RASH/RASK/RASN antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from human RASH/RASK/RASN antibody.

Rabbit Polyclonal CXCR4 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide made to a C-terminal region of the human CXCR4 protein (within residues 300-352). [Swiss-Prot P61073]

Rabbit Polyclonal Anti-MET Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human MET

Rabbit Polyclonal CXCR4 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen DNA immunization. This antibody is specific for the N Terminus Region of the target protein.

Rabbit Polyclonal CXCR4 Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen CXCR4 antibody was raised against a 15 amino acid peptide near the center of human CXCR4. The immunogen is located within amino acids 170 - 220 of CXCR4.

Rabbit Polyclonal PAK4 Antibody

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen PAK4 antibody was raised against a 13 amino acid peptide from near the center of human PAK4.

Rabbit Polyclonal PAK2 Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen PAK2 antibody was raised against a 14 amino acid peptide from near the carboxy terminus of human PAK2.

Rabbit Polyclonal CXCR4-Lo Antibody

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen CXCR4-Lo antibody was raised against a peptide corresponding to nine amino acids near the amino terminus of human CXCR4 isoform a.

Rabbit polyclonal antibody to Cofilin 2 (cofilin 2 (muscle))

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region within amino acids 92 and 166 of Cofilin 2