ADAM8 (763-824) rabbit polyclonal antibody, Purified
Applications | IHC, WB |
Reactivities | Human |
Immunogen | Synthetic peptide contain a sequence corresponding to a region within amino acids 763 and 824 of Human CD156 |
ADAM8 (763-824) rabbit polyclonal antibody, Purified
Applications | IHC, WB |
Reactivities | Human |
Immunogen | Synthetic peptide contain a sequence corresponding to a region within amino acids 763 and 824 of Human CD156 |
Rabbit anti CD156b (IN) Polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide corresponding to the human CD156b at extracellular domain. This sequence is identical among human, mouse or rat origins. |
Rabbit Polyclonal Anti-ADAM8 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-ADAM8 antibody: synthetic peptide directed towards the N terminal of human ADAM8. Synthetic peptide located within the following region: LHLRKNRDLLGSGYTETYTAANGSEVTEQPRGQDHCFYQGHVEGYPDSAA |
Rabbit anti CD156b (NT) Polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide corresponding to the human CD156b at Pro- domain. This sequence is identical among human, mouse and/or rat origins. |
Rabbit anti CD156b Polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide corresponding to the human CD156b at Pro- domain. This sequence is identical among human, mouse and/or rat origins. |
ADAM8 Antibody - N-terminal region
Applications | WB |
Reactivities | Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of mouse ADAM8 |
ADAM8 Rabbit polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 17-300 of human ADAM8 (NP_001100.3). |
Modifications | Unmodified |
ADAM8 Rabbit polyclonal Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 17-300 of human ADAM8 (NP_001100.3). |
Modifications | Unmodified |
MS2 Rabbit monoclonal Antibody
Applications | IP, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |