Rabbit Polyclonal Anti-NOX2 Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Rabbit polyclonal NOX2 antibody was raised against a 15 amino acid peptide near the amino terminus of human NOX2. |
Rabbit Polyclonal Anti-NOX2 Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Rabbit polyclonal NOX2 antibody was raised against a 15 amino acid peptide near the amino terminus of human NOX2. |
Rabbit anti-CYBB Polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human CYBB |
Rabbit Polyclonal Anti-CYBB Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-CYBB antibody is: synthetic peptide directed towards the C-terminal region of Human CYBB. Synthetic peptide located within the following region: GRPNWDNEFKTIASQHPNTRIGVFLCGPEALAETLSKQSISNSESGPRGV |
NOX2/gp91phox Rabbit polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide corresponding to a sequence within amino acids 100-200 of human NOX2/gp91phox (NP_000388.2). |
Modifications | Unmodified |
NOX2 Rabbit polyclonal Antibody
Applications | ELISA, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from the Internal region of human CYBB. AA range:111-160 |