EBF2 rabbit polyclonal antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human EBF2 |
EBF2 rabbit polyclonal antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human EBF2 |
Rabbit Polyclonal Anti-EBF2 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-EBF2 Antibody is: synthetic peptide directed towards the C-terminal region of Human EBF2. Synthetic peptide located within the following region: DIAEALYSVPRNPSQLPALSSSPAHSGMMGINSYGSQLGVSISESTQGNN |
Rabbit Polyclonal Anti-EBF2 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-EBF2 antibody: synthetic peptide directed towards the middle region of human EBF2. Synthetic peptide located within the following region: GDPERLAKEMLLKRAADLVEALYGTPHNNQDIILKRAADIAEALYSVPRN |
EBF2 Antibody - C-terminal region
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen is a synthetic peptide directed towards the C terminal region of human EBF2 |
EBF2 rabbit polyclonal antibody
Applications | IHC |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human EBF2 |