Rabbit polyclonal anti-AGPAT5 antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human AGPAT5. |
Rabbit polyclonal anti-AGPAT5 antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human AGPAT5. |
Rabbit Polyclonal Anti-AGPAT5 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-AGPAT5 antibody: synthetic peptide directed towards the N terminal of human AGPAT5. Synthetic peptide located within the following region: RLLSAFLPARFYQALDDRLYCVYQSMVLFFFENYTGVQILLYGDLPKNKE |
AGPAT5 Rabbit polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 120-320 of human AGPAT5 (NP_060831.2). |
Modifications | Unmodified |