CD40L (CD40LG) (N-term) rabbit polyclonal antibody, Aff - Purified
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Immunogen | Synthetic peptide corresponding to a sequence at the N-terminal of human CD40L |
CD40L (CD40LG) (N-term) rabbit polyclonal antibody, Aff - Purified
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Immunogen | Synthetic peptide corresponding to a sequence at the N-terminal of human CD40L |
Rabbit Polyclonal Anti-CD40LG Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-CD40LG antibody: synthetic peptide directed towards the middle region of human CD40LG. Synthetic peptide located within the following region: ENSFEMQKGDQNPQIAAHVISEASSKTTSVLQWAEKGYYTMSNNLVTLEN |
CD40L (CD40LG) (C-term) rabbit polyclonal antibody
Applications | FC, WB |
Reactivities | Human |
Immunogen | KLH conjugated synthetic peptide selected from the C-terminal region of human TRAP |
CD40L (CD40LG) (N-term) rabbit polyclonal antibody
Applications | WB |
Reactivities | Human |
Immunogen | KLH conjugated synthetic peptide selected from the N-terminal region of human TRAP |
Rabbit anti CD154 Polyclonal Antibody
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to aa 51-69 of human CD154. |
Rabbit Polyclonal Anti-CD40LG Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human CD40LG |
CD40L Rabbit polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 47-223 of human CD40L (NP_000065.1). |
Modifications | Unmodified |
CD40L Rabbit polyclonal Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide corresponding to a sequence within amino acids 79-129 of human CD40L (NP_000065.1). |
Modifications | Unmodified |
USD 523.00
2 Weeks
Recombinant Anti-CD40L (Clone hu5c8 (Ruplizumab))
Applications | FC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Modifications | NOT FOR THERAPEUTIC USE - This is a research-grade biosimilar. This chimeric rabbit antibody was made using the variable domain sequences of the original Human IgG1 format, for improved compatibility with existing reagents, assays and techniques. |
Recombinant Anti-CD154 (Clone YMF323.6)
Applications | FC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Modifications | This chimeric rabbit antibody was made using the variable domain sequences of the original Rat IgG2a format, for improved compatibility with existing reagents, assays and techniques. |
Recombinant Anti-CD40L (Clone AT161-8)
Applications | FC, IF |
Reactivities | Human |
Conjugation | Unconjugated |
Modifications | This chimeric rabbit antibody was made using the variable domain sequences of the original Mouse IgG1 format, for improved compatibility with existing reagents, assays and techniques. |
Recombinant Anti-CD40L (Clone AT161-10)
Applications | ELISA |
Reactivities | Human |
Conjugation | Unconjugated |
Modifications | This chimeric rabbit antibody was made using the variable domain sequences of the original Mouse IgG1 format, for improved compatibility with existing reagents, assays and techniques. |
Recombinant Anti-CD40L (Clone MR1)
Applications | Bl, FC |
Reactivities | Mouse |
Conjugation | Unconjugated |
Modifications | This chimeric rabbit antibody was made using the variable domain sequences of the original Hamster IgG format, for improved compatibility with existing reagents, assays and techniques. |
USD 523.00
2 Weeks
Recombinant Anti-CD154 (Clone IDEC-131 (Toralizumab))
Applications | IF |
Reactivities | Human |
Conjugation | Unconjugated |
Modifications | This chimeric rabbit antibody was made using the variable domain sequences of the original Human IgG1 format, for improved compatibility with existing reagents, assays and techniques. |
Recombinant Anti-CD40 (Clone chi220)
Reactivities | Human |
Conjugation | Unconjugated |
Modifications | This chimeric rabbit antibody was made using the variable domain sequences of the original Mouse IgG2a format, for improved compatibility with existing reagents, assays and techniques. |