Rabbit Polyclonal FOXP3 Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Rabbit polyclonal FOXP3 antibody was raised against a 15 amino acid peptide near the carboxy terminus of human FOXP3. The immunogen is located within the last 50 amino acids of FOXP3. |
Rabbit Polyclonal Anti-FOXP3 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-FOXP3 antibody: synthetic peptide directed towards the N terminal of human FOXP3. Synthetic peptide located within the following region: PHFMHQLSTVDAHARTPVLQVHPLESPAMISLTPPTTATGVFSLKARPGL |
beta Catenin (CTNNB1) rabbit monoclonal antibody, clone E247, Supernatant
| Applications | IHC |
| Reactivities | Human |
alpha 1 Fetoprotein (AFP) rabbit polyclonal antibody, Purified
| Applications | IHC |
| Reactivities | Human |
| Immunogen | Human Alpha-Fetoprotein purified from Human cord serum |
Rabbit Polyclonal Antibody against FOXP3
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide made to the N-terminal region of human FOXP3 (between residues 1-50). |
Rabbit Polyclonal Anti-Foxp3 Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-Foxp3 antibody is: synthetic peptide directed towards the N-terminal region of Mouse Foxp3. Synthetic peptide located within the following region: LPSWKTAPKGSELLGTRGSGGPFQGRDLRSGAHTSSSLNPLPPSQLQLPT |
Rabbit anti FOXP3 Polyclonal Antibody
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide corresponding to the C-terminus of human FOXP3 protein. This sequence is identical within human, mouse, rat origins. |
Anti-FOXP3 Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 410-424 amino acids of Human forkhead box P3 |
FOXP3 Rabbit polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide corresponding to a sequence within amino acids 50-150 of human FOXP3 (NP_054728.2). |
| Modifications | Unmodified |
FOXP3 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 180-300 of human FOXP3 (NP_001107849.1). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China
