Rabbit Polyclonal Anti-SELPLG Antibody
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human SELPLG |
Rabbit Polyclonal Anti-SELPLG Antibody
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human SELPLG |
SELPLG Rabbit Polyclonal Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human SELPLG |
CD162 (SELPLG) (C-term) rabbit polyclonal antibody, Aff - Purified
Applications | FC, WB |
Reactivities | Human |
Immunogen | KLH conjugated synthetic peptide between 386-413 amino acids from the C-terminal region of Human SELPLG |
Rabbit Polyclonal Anti-SELPLG Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-SELPLG antibody is: synthetic peptide directed towards the C-terminal region of Human SELPLG. Synthetic peptide located within the following region: EMVCISSLLPDGGEGPSATANGGLSKAKSPGLTPEPREDREGDDLTLHSF |
Rabbit Polyclonal Anti-SELPLG Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-SELPLG antibody is: synthetic peptide directed towards the N-terminal region of Human SELPLG. Synthetic peptide located within the following region: GNSLQLWDTWADEAEKALGPLLARDRRQATEYEYLDYDFLPETEPPEMLR |
SELPLG rabbit polyclonal antibody
Applications | ELISA, IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human SELPLG |