Rabbit polyclonal anti-SLU7 antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | he antiserum was produced against synthesized peptide derived from internal of human SLU7. |
Rabbit polyclonal anti-SLU7 antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | he antiserum was produced against synthesized peptide derived from internal of human SLU7. |
Rabbit Polyclonal Anti-SLU7 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-SLU7 antibody: synthetic peptide directed towards the N terminal of human SLU7. Synthetic peptide located within the following region: KKKELEEQRKLGNAPAEVDEEGKDINPHIPQYISSVPWYIDPSKRPTLKH |
Slu7 Antibody - middle region
Applications | WB |
Reactivities | Mouse |
Conjugation | Unconjugated |
SLU7 Rabbit polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-300 of human SLU7 (NP_006416.3). |
Modifications | Unmodified |