Rabbit polyclonal anti-LEG8 antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human LEG8. |
Rabbit polyclonal anti-LEG8 antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human LEG8. |
Rabbit Polyclonal Anti-LGALS8 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-LGALS8 Antibody: synthetic peptide directed towards the C terminal of human LGALS8. Synthetic peptide located within the following region: FPFSPGMYFEMIIYCDVREFKVAVNGVHSLEYKHRFKELSSIDTLEINGD |
Anti-LGALS8 Rabbit Polyclonal Antibody
Applications | ELISA, IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein corresponding to a region derived from 187-317 amino acids of human lectin, galactoside-binding, soluble, 8 |
Anti-LGALS8 Rabbit Polyclonal Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein corresponding to a region derived from 187-317 amino acids of human lectin, galactoside-binding, soluble, 8 |
Galectin 8/LGALS8 Rabbit polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 20-317 of human Galectin 8/Galectin 8/LGALS8 (NP_963838.1). |
Modifications | Unmodified |
Galectin 8/LGALS8 Rabbit polyclonal Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 20-317 of human Galectin 8/Galectin 8/LGALS8 (NP_963838.1). |
Modifications | Unmodified |