Antibodies

View as table Download

Rabbit Polyclonal Anti-PENK Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PENK antibody: synthetic peptide directed towards the middle region of human PENK. Synthetic peptide located within the following region: DAEEDDSLANSSDLLKELLETGDNRERSHHQDGSDNEEEVSKRYGGFMRG

Rabbit polyclonal anti Met-Enkephalin; neat antiserum

Applications ELISA
Reactivities Human, Mammalian
Conjugation Unconjugated
Immunogen Synthetic peptide H-Try-Gly-Gly-Phe-Met-OH coupled to carrier protein.

Rabbit polyclonal anti BAM-12P; purified rabbit IgG

Applications ELISA
Reactivities Human, Mammalian
Conjugation Unconjugated
Immunogen Synthetic peptide H-Try-Gly-Gly-Phe-Met-Arg-Arg-Val-Gly-Arg-Pro-Glu- NH2 coupled to a carrier protein.

Rabbit polyclonal anti BAM-22P; neat antiserum

Applications ELISA
Reactivities Human, Mammalian
Conjugation Unconjugated
Immunogen Synthetic peptide H-Tyr-Gly-Gly-Phe-Met-Arg-Arg-Val-Gly-Arg-Pro-Glu- Trp-Trp-Met-Asp-Tyr-Gln-Lys-Arg-Tyr-Gly-NH2 coupled to a carrier protein.

Rabbit polyclonal anti BAM-22P; purified rabbit IgG

Applications ELISA
Reactivities Human, Mammalian
Conjugation Unconjugated
Immunogen Synthetic peptide H-Tyr-Gly-Gly-Phe-Met-Arg-Arg-Val-Gly-Arg-Pro-Glu- Trp-Trp-Met-Asp-Tyr-Gln-Lys-Arg-Tyr-Gly-NH2 coupled to a carrier protein.

Rabbit polyclonal anti BAM-12P; neat antiserum

Applications ELISA
Reactivities Human, Mammalian
Conjugation Unconjugated
Immunogen Synthetic peptide H-Try-Gly-Gly-Phe-Met-Arg-Arg-Val-Gly-Arg-Pro-Glu- NH2 coupled to carrier protein.

Rabbit polyclonal anti Leu-Enkephalin; diluted antiserum

Applications ELISA
Reactivities Human, Mammalian
Conjugation Unconjugated
Immunogen Synthetic peptide H-Tyr-Gly-Gly-Phe-Leu-NH2 coupled to carrier protein.

Rabbit polyclonal anti Leu-Enkephalin; purified rabbit IgG

Applications ELISA
Reactivities Human, Mammalian
Conjugation Unconjugated
Immunogen Synthetic peptide H-Tyr-Gly-Gly-Phe-Leu-NH2 coupled to a carrier protein.

Rabbit polyclonal anti Leu-Enkephalin; neat antiserum

Applications ELISA
Reactivities Human, Mammalian
Conjugation Unconjugated
Immunogen Synthetic peptide H-Tyr-Gly-Gly-Phe-Leu-NH2 coupled to carrier protein.

Rabbit polyclonal anti Met-Enkephalin; diluted antiserum

Applications ELISA
Reactivities Human, Mammalian
Conjugation Unconjugated
Immunogen Synthetic peptide H-Try-Gly-Gly-Phe-Met-OH coupled to carrier protein.

Rabbit polyclonal anti Met-Enkephalin-Arg-Gly-Leu; neat antiserum

Applications ELISA
Reactivities Human, Mammalian
Conjugation Unconjugated
Immunogen Synthetic peptide H-Tyr-Gly-Gly-Phe-Met-Arg-Gly-Leu-NH2 coupled to carrier protein.

Rabbit polyclonal anti Met-Enkephalin-Arg-Gly-Leu; purified rabbit IgG

Applications ELISA
Reactivities Human, Mammalian
Conjugation Unconjugated
Immunogen Synthetic peptide H-Tyr-Gly-Gly-Phe-Met-Arg-Gly-Leu-NH2 coupled to a carrier protein.

Rabbit polyclonal anti Met-Enkephalin; purified rabbit IgG

Applications ELISA
Reactivities Human, Mammalian
Conjugation Unconjugated
Immunogen Synthetic peptide H-Try-Gly-Gly-Phe-Met-OH coupled to a carrier protein.

Rabbit polyclonal anti Met-Enkephalin-Arg-Phe; neat antiserum

Applications ELISA
Reactivities Human, Mammalian
Conjugation Unconjugated
Immunogen Synthetic peptide H-Tyr-Gly-Gly-Phe-Met-Arg-Phe-NH2 coupled to carrier protein.

Rabbit polyclonal anti Met-Enkephalin-Arg-Phe; purified rabbit IgG

Applications ELISA
Reactivities Human, Mammalian
Conjugation Unconjugated
Immunogen Synthetic peptide H-Tyr-Gly-Gly-Phe-Met-Arg-Phe-NH2 coupled to a carrier protein.

PENK Rabbit polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 25-267 of human PENK (NP_001129162.1).
Modifications Unmodified