Rabbit Polyclonal Antibody against ABCE1
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | A fusion protein containing amino acids 1-119 of the ABCE1 protein. |
Rabbit Polyclonal Antibody against ABCE1
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | A fusion protein containing amino acids 1-119 of the ABCE1 protein. |
Rabbit Polyclonal Anti-ABCE1 Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-ABCE1 Antibody: synthetic peptide directed towards the C terminal of human ABCE1. Synthetic peptide located within the following region: LAGMNKFLSQLEITFRRDPNNYRPRINKLNSIKDVEQKKSGNYFFLDD |
Anti-ABCE1 Rabbit Polyclonal Antibody
Applications | ELISA, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein corresponding to a region derived from 345-562 amino acids of human ATP-binding cassette, sub-family E (OABP), member 1 |
Anti-ABCE1 Rabbit Polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein corresponding to a region derived from 345-562 amino acids of human ATP-binding cassette, sub-family E (OABP), member 1 |