Rabbit polyclonal anti-TAF1A antibody
Applications | WB |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human TAF1A. |
Rabbit polyclonal anti-TAF1A antibody
Applications | WB |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human TAF1A. |
Rabbit Polyclonal Anti-TAF1A Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-TAF1A antibody: synthetic peptide directed towards the C terminal of human TAF1A. Synthetic peptide located within the following region: CEKAFVAGLLLGKGCRYFRYILKQDHQILGKKIKRMKRSVKKYSIVNPRL |
TAF1 48 (TAF1A) (N-term) rabbit polyclonal antibody, Aff - Purified
Applications | WB |
Reactivities | Human |
Immunogen | KLH conjugated synthetic peptide between 67-97 amino acids from the N-terminal region of human TAF1A |
Rabbit Polyclonal Anti-TAF1A Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-TAF1A antibody: synthetic peptide directed towards the N terminal of human TAF1A. Synthetic peptide located within the following region: CLSFIQEALLKHQWQQAAEYMYSYFQTLEDSDSYKRQAAPEIIWKLGSEI |
Rabbit Polyclonal Anti-Taf1a Antibody
Applications | WB |
Reactivities | Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-Taf1a antibody is: synthetic peptide directed towards the N-terminal region of Rat Taf1a. Synthetic peptide located within the following region: FAQTTSACLSFLQEALLKHQWCRAAEYMHSYLQTLEDSDTYRKQAAPEII |