Rabbit anti-CBX5 Polyclonal Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human CBX5 |
Rabbit anti-CBX5 Polyclonal Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human CBX5 |
Rabbit Polyclonal HP1alpha/beta/gamma Antibody
Applications | IF, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-HP1.,.,. antibody: human HP1 . (Heterochromatin protein 1 homolog beta), using the full length recombinant GST tagged protein. The antibody also recognizes the . and . isoforms. |
Rabbit Polyclonal HP1alpha Antibody
Applications | IF, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-HP1. antibody: human HP1. (Heterochromatin protein 1 homolog alpha), using the full length recombinant GST tagged protein. |
Rabbit Polyclonal Anti-CBX5 Antibody
Applications | IF, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-CBX5 antibody: synthetic peptide directed towards the middle region of human CBX5. Synthetic peptide located within the following region: KYKKMKEGENNKPREKSESNKRKSNFSNSADDIKSKKKREQSNDIARGFE |
HP1 alpha/CBX5 Rabbit polyclonal Antibody
Applications | IF, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-100 of human HP1 alpha/HP1 alpha/CBX5 (NP_001120794.1). |
Modifications | Unmodified |
HP1 alpha Mouse monoclonal Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
HP1 alpha Rabbit polyclonal Antibody
Applications | FC, IF, IHC, IP, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | A synthesized peptide derived from human HP1 alpha |