Rabbit anti-HK2 Polyclonal Antibody
Applications | ICC/IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human HK2 |
Rabbit anti-HK2 Polyclonal Antibody
Applications | ICC/IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human HK2 |
Rabbit polyclonal HK2 (Hexokinase II) Antibody (N-term)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | This HK2 (Hexokinase II) antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 91-121 amino acids from the N-terminal region of human HK2 (Hexokinase II). |
Rabbit Polyclonal Anti-HK2 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-HK2 Antibody: synthetic peptide directed towards the N terminal of human HK2. Synthetic peptide located within the following region: GTEHGEFLALDLGGTNFRVLWVKVTDNGLQKVEMENQIYAIPEDIMRGSG |
Rabbit Polyclonal Anti-HK2 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human HK2 |