Antibodies

View as table Download

DCX rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide of human DCX

Rabbit Polyclonal Anti-DCX Antibody

Applications IHC, WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-DCX antibody: synthetic peptide directed towards the C terminal of human DCX. Synthetic peptide located within the following region: PEKFRYAQDDFSLDENECRVMKGNPSATAGPKASPTPQKTSAKSPGPMRR

Doublecortin (DCX) mouse monoclonal antibody

Applications IF, IHC, WB
Reactivities Bovine, Human, Mouse, Porcine, Rat
Conjugation Unconjugated

Doublecortin (DCX) mouse monoclonal antibody

Applications IF, IHC, WB
Reactivities Bovine, Chicken, Equine, Human, Mouse, Porcine, Primate, Rat
Conjugation Unconjugated

DCX rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide of human DCX