Antibodies

Jump to Filters
View as table Download
MYF6 Rabbit Polyclonal Antibody
TA329910

USD 375.00

5 Days

Rabbit Polyclonal Anti-MYF6 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-MYF6 antibody: synthetic peptide directed towards the N terminal of human MYF6. Synthetic peptide located within the following region: PGLQPPHCPGQCLIWACKTCKRKSAPTDRRKAATLRERRRLKKINEAFEA