Antibodies

Jump to Filters
View as table Download
FOXQ1 Rabbit Polyclonal Antibody
TA372582

USD 380.00

4 Weeks

FOXQ1 rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide of human FOXQ1
FOXQ1 Rabbit Polyclonal Antibody
TA345478

USD 410.00

5 Days

Rabbit Polyclonal Anti-FOXQ1 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-FOXQ1 antibody: synthetic peptide directed towards the N terminal of human FOXQ1. Synthetic peptide located within the following region: PSPLSAAGDDSLGSDGDCAANSPAAGGGARDPPGDGEQSAGGGPGAEEAI
FOXQ1 Rabbit Polyclonal Antibody
TA334252

USD 375.00

5 Days

Rabbit Polyclonal Anti-FOXQ1 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-FOXQ1 antibody: synthetic peptide directed towards the N terminal of human FOXQ1. Synthetic peptide located within the following region: MKLEVFVPRAAHGDKQGSDLEGAGGSDAPSPLSAAGDDSLGSDGDCAANS
FOXQ1 Mouse Monoclonal Antibody [Clone ID: 2E2]
AM31948PU-N

USD 480.00

2 Weeks

FOXQ1 mouse monoclonal antibody, clone 2E2, Purified

Applications ELISA, IHC
Reactivities Human
FOXQ1 Mouse Monoclonal Antibody [Clone ID: OTI4D9]
CF808148

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) FOXQ1 mouse monoclonal antibody,clone OTI4D9

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
FOXQ1 Rabbit Polyclonal Antibody
TA368338

USD 380.00

4 Weeks

FOXQ1 rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide of human FOXQ1
FOXQ1 Mouse Monoclonal Antibody [Clone ID: OTI4D9]
TA808148

USD 379.00

In Stock

FOXQ1 mouse monoclonal antibody,clone OTI4D9

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
FOXQ1 Mouse Monoclonal Antibody [Clone ID: OTI4D9]
TA808148S

USD 159.00

2 Days

FOXQ1 mouse monoclonal antibody,clone OTI4D9

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated