Antibodies

View as table Download

Rabbit Polyclonal Anti-MBP Antibody

Applications IHC, IP, WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen The immunogen for Anti-MBP Antibody: synthetic peptide directed towards the middle region of human MBP. Synthetic peptide located within the following region: FGGDRGAPKRGSGKDSHHPARTAHYGSLPQKSHGRTQDENPVVHFFKNIV

Myelin Basic Protein (MBP) (C-term) rabbit polyclonal antibody, Aff - Purified

Applications IF, IHC, IP, WB
Reactivities Human, Mouse, Rat
Immunogen Synthetic peptide corresponding to a sequence at the C-terminal of the human MBP