ADRB2 rabbit polyclonal antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human ADRB2 |
ADRB2 rabbit polyclonal antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human ADRB2 |
Rabbit polyclonal anti-ADRB2 antibody
Applications | IF, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human ADRB2. |
beta 2 Adrenergic Receptor (ADRB2) rabbit polyclonal antibody, Aff - Purified
Applications | IF, IHC, WB |
Reactivities | Human |
Immunogen | Synthetic peptide, corresponding to amino acids 311-360 of Human AR-β2. |
Rabbit Polyclonal Adrenergic Receptor beta2 (Ser346) Antibody (Phospho-specific)
Applications | WB |
Reactivities | Human:S346 |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against A synthesized peptide derived from human Adrenergic Receptor beta2 around the phosphorylation site of Serine 346 |
Modifications | Phospho-specific |
Rabbit polyclonal anti-ADRB2 antibody
Applications | IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from C-terminal of human ADRB2. |
Rabbit Polyclonal Anti-beta2-Adrenoceptor (extracellular)
Applications | IHC, WB |
Reactivities | Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Peptide (C)NGSRAPDHDVTQERDE, corresponding to amino acid residues 15-30 of mouse Ã?2-Adrenoceptor. Extracellular, N-terminus. |
Goat Polyclonal Antibody against ADRB2
Applications | WB |
Reactivities | Human, Cow |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-HQGTVPSDNIDSQ, from the C Terminus of the protein sequence according to NP_000015.1. |
Rabbit Polyclonal Adrenergic Receptor beta2 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against A synthesized peptide derived from human Adrenergic Receptor beta2 |
Rabbit Polyclonal Anti-ADRB2 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-ADRB2 antibody: synthetic peptide directed towards the middle region of human ADRB2. Synthetic peptide located within the following region: TGEQSGYHVEQEKENKLLCEDLPGTEDFVGHQGTVPSDNIDSQGRNCSTN |
Anti-ADRB2 Rabbit Polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide peptide corresponding to a region derived from 21-33 amino acids of human adrenoceptor beta 2, surface |
Anti-ADRB2 Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 21-33 amino acids of Human adrenoceptor beta 2, surface |
ADRB2 Rabbit polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 334-413 of human ADRB2 (NP_000015.1). |
Modifications | Unmodified |