Rpia (Center) rabbit polyclonal antibody, Aff - Purified
Applications | WB |
Reactivities | Human, Mouse |
Immunogen | Synthetic peptide directed towards the middle region of mouse Rpia |
Rpia (Center) rabbit polyclonal antibody, Aff - Purified
Applications | WB |
Reactivities | Human, Mouse |
Immunogen | Synthetic peptide directed towards the middle region of mouse Rpia |
Rabbit Polyclonal Anti-RPIA Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-RPIA Antibody: synthetic peptide directed towards the N terminal of human RPIA. Synthetic peptide located within the following region: MQRPGPFSTLYGRVLAPLPGRAGGAASGGGGNSWDLPGSHVRLPGRAQSG |
Rpia Antibody - middle region
Applications | WB |
Reactivities | Mouse |
Conjugation | Unconjugated |
RPIA Rabbit polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 82-311 of human RPIA (NP_653164.2). |
Modifications | Unmodified |