Rabbit polyclonal Cytochrome P450 7B1 antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human Cytochrome P450 7B1. |
Rabbit polyclonal Cytochrome P450 7B1 antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human Cytochrome P450 7B1. |
CYP7B1 rabbit polyclonal antibody, Aff - Purified
Applications | IHC, WB |
Reactivities | Human |
Rabbit Polyclonal Anti-CYP7B1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-CYP7B1 antibody: synthetic peptide directed towards the C terminal of human CYP7B1. Synthetic peptide located within the following region: AMYYLLRHPEAMAAVRDEIDRLLQSTGQKKGSGFPIHLTREQLDSLICLE |
Mouse monoclonal Anti-Cytochrome P450 7B1 Clone M17-P3F2
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
CYP7B1 rabbit polyclonal antibody
Applications | WB |
Reactivities | Human |
Immunogen | KLH conjugated synthetic peptide selected from the Center region of human CYP7B1 |
Carrier-free (BSA/glycerol-free) Cyp7b1 mouse monoclonal antibody, clone OTI7H10 (formerly 7H10)
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) CYP7B1 mouse monoclonal antibody,clone OTI1G7
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
CYP7B1 Rabbit polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide corresponding to a sequence within amino acids 200-300 of human CYP7B1 (NP_004811.1). |
Modifications | Unmodified |
Anti-Cyp7b1 mouse monoclonal antibody, clone OTI7H10 (formerly 7H10)
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
Anti-Cyp7b1 mouse monoclonal antibody, clone OTI7H10 (formerly 7H10), Biotinylated
Applications | WB |
Reactivities | Human |
Conjugation | Biotin |
Anti-Cyp7b1 mouse monoclonal antibody, clone OTI7H10 (formerly 7H10), HRP conjugated
Applications | WB |
Reactivities | Human |
Conjugation | HRP |
Anti-Cyp7b1 mouse monoclonal antibody, clone OTI7H10 (formerly 7H10)
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
CYP7B1 mouse monoclonal antibody,clone OTI1G7
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
CYP7B1 mouse monoclonal antibody,clone OTI1G7, Biotinylated
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Biotin |
CYP7B1 mouse monoclonal antibody,clone OTI1G7, HRP conjugated
Applications | IHC, WB |
Reactivities | Human |
Conjugation | HRP |
CYP7B1 mouse monoclonal antibody,clone OTI1G7
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |