Rabbit polyclonal Anti-ARMC8 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ARMC8 antibody: synthetic peptide directed towards the N terminal of human ARMC8. Synthetic peptide located within the following region: KVLQGVIDMKNAVIGNNKQKANLIVLGAVPRLLYLLQQETSSTELKTECA |
Rabbit polyclonal Anti-ARMC8 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ARMC8 antibody: synthetic peptide directed towards the N terminal of human ARMC8. Synthetic peptide located within the following region: MEVTASSRHYVDRLFDPDPQKVLQGVIDMKNAVIGNNKQKANLIVLGAVP |
Germany
Japan
United Kingdom
China