LRRN4CL (Center) rabbit polyclonal antibody, Aff - Purified
Applications | IHC, WB |
Reactivities | Human |
Immunogen | KLH conjugated synthetic peptide between 124-154 amino acids from the Central region of human LRRN4CL |
LRRN4CL (Center) rabbit polyclonal antibody, Aff - Purified
Applications | IHC, WB |
Reactivities | Human |
Immunogen | KLH conjugated synthetic peptide between 124-154 amino acids from the Central region of human LRRN4CL |
Rabbit Polyclonal Anti-LRRN4CL Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-LRRN4CL Antibody: synthetic peptide directed towards the middle region of human LOC221091. Synthetic peptide located within the following region: PFSPVLHYWLLLWDGSEAAQKGPPLNATVRRAELKGLKPGGIYVVCVVAA |