Antibodies

View as table Download

Rabbit Polyclonal Anti-SMYD3 Antibody

Applications 10k-ChIP, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SMYD3 antibody: synthetic peptide directed towards the N terminal of human SMYD3. Synthetic peptide located within the following region: PRYPPDSVRLLGRVVFKLMDGAPSESEKLYSFYDLESNINKLTEDKKEGL

SMYD3 (N-term) rabbit polyclonal antibody

Applications WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide selected from the N-terminal region of human SMYD3

Rabbit Polyclonal Anti-SMYD3 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SMYD3 antibody: synthetic peptide directed towards the C terminal of human SMYD3. Synthetic peptide located within the following region: LHQGMFPQAMKNLRLAFDIMRVTHGREHSLIEDLILLLEECDANIRAS

Rabbit Polyclonal Anti-SMYD3 rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein of human SMYD3

SMYD3 Rabbit polyclonal Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide corresponding to a sequence within amino acids 50-150 of human SMYD3 (NP_001161212.1).
Modifications Unmodified

SMYD3 Rabbit polyclonal Antibody

Applications IF, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 140-369 of human SMYD3 (NP_073580.1).
Modifications Unmodified

SMYD3 Rabbit polyclonal Antibody

Applications FC, IF, IHC, IP, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthesized peptide derived from human SMYD3