ZNF780A (N-term) rabbit polyclonal antibody, Aff - Purified
Applications | WB |
Reactivities | Human |
Immunogen | KLH conjugated synthetic peptide between 61-91 amino acids from the N-terminal region of human ZNF780A |
ZNF780A (N-term) rabbit polyclonal antibody, Aff - Purified
Applications | WB |
Reactivities | Human |
Immunogen | KLH conjugated synthetic peptide between 61-91 amino acids from the N-terminal region of human ZNF780A |
Rabbit Polyclonal Anti-ZNF780A Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-ZNF780A antibody: synthetic peptide directed towards the N terminal of human ZNF780A. Synthetic peptide located within the following region: TSRRYPDLELKYGPEKVSPENDTSEVNLPKQVIKQISTTLGIEAFYFRND |
ZNF780A Antibody - N-terminal region
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |