Rabbit polyclonal anti-ATP5H antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of humanATP5H. |
Rabbit polyclonal anti-ATP5H antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of humanATP5H. |
Rabbit Polyclonal Anti-ATP5H Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-ATP5H antibody: synthetic peptide directed towards the C terminal of human ATP5H. Synthetic peptide located within the following region: CAEWVSLSKARIVEYEKEMEKMKNLIPFDQMTIEDLNEAFPETKLDKKKY |