Rabbit anti-SHMT2 Polyclonal Antibody
Applications | ICC/IF, IHC, IP, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human SHMT2 |
Rabbit anti-SHMT2 Polyclonal Antibody
Applications | ICC/IF, IHC, IP, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human SHMT2 |
GGT1 Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human GGT1 |
GGT1 (381-471) mouse monoclonal antibody, clone 1F9, Purified
Applications | ELISA, IHC, IP, WB |
Reactivities | Human, Mouse |
SHMT1 (374-483) mouse monoclonal antibody, clone 4F9, Purified
Applications | ELISA, IHC, WB |
Reactivities | Human |
Rabbit polyclonal anti-GBA3 antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human GBA3. |
Rabbit polyclonal Gamma-glutamyltransferase 4 (heavy chain, Cleaved-Thr472) antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from human Gamma-glutamyltransferase 4. |
Anti-GGT1 Rabbit Polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein corresponding to C terminal 200 amino acids of human gamma-glutamyltransferase 1 |
GBA3 (C-term) rabbit polyclonal antibody, Aff - Purified
Applications | IHC, WB |
Reactivities | Human |
Immunogen | KLH conjugated synthetic peptide between 295-325 amino acids from the C-terminal region of Human Cytosolic beta-glucosidase |
Rabbit Polyclonal antibody to GGT1 (gamma-glutamyltransferase 1)
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment corresponding to a region within amino acids 1 and 226 of GGT1 (Uniprot ID#P19440) |
Rabbit Polyclonal Anti-SHMT2 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-SHMT2 antibody: synthetic peptide directed towards the N terminal of human SHMT2. Synthetic peptide located within the following region: ELIASENFCSRAALEALGSCLNNKYSEGYPGKRYYGGAEVVDEIELLCQR |
Rabbit Polyclonal Anti-SHMT2 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-SHMT2 antibody: synthetic peptide directed towards the C terminal of human SHMT2. Synthetic peptide located within the following region: ELVSITANKNTCPGDRSAITPGGLRLGAPALTSRQFREDDFRRVVDFIDE |
GBA3 Capture mouse monoclonal antibody, ELISA and Luminex validated, clone OTI1C7
Applications | ELISA, LMNX |
Reactivities | Human |
Conjugation | Unconjugated |
Matched ELISA Pair | TA700050 |
GBA3 Capture mouse monoclonal antibody, ELISA and Luminex validated, clone OTI1F1
Applications | ELISA, LMNX |
Reactivities | Human |
Conjugation | Unconjugated |
Matched ELISA Pair | TA700050 |
GGT5 (N-term) rabbit polyclonal antibody
Applications | WB |
Reactivities | Human, Mouse |
Immunogen | KLH conjugated synthetic peptide selected from the N-terminal region of human GGTLA1 |
Anti-SHMT2 Rabbit Polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein corresponding to C terminal 240 amino acids of human serine hydroxymethyltransferase 2 (mitochondrial) |
Rabbit polyclonal Anti-SHMT1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-SHMT1 antibody: synthetic peptide directed towards the N terminal of human SHMT1. Synthetic peptide located within the following region: NIIKKESNRQRVGLELIASENFASRAVLEALGSCLNNKYSEGYPGQRYYG |
Rabbit polyclonal Anti-GGTL3 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-GGTL3 antibody: synthetic peptide directed towards the C terminal of human GGTL3. Synthetic peptide located within the following region: ILLNSQMLDFSWPNRTANHSAPSLENSVQPGKRPLSFLLPTVVRPAEGLC |
Carrier-free (BSA/glycerol-free) GBA3 mouse monoclonal antibody, clone OTI3E8 (formerly 3E8)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) GBA3 mouse monoclonal antibody, clone OTI5G5 (formerly 5G5)
Applications | FC, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) GBA3 mouse monoclonal antibody, clone OTI4G8 (formerly 4G8)
Applications | FC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) GBA3 mouse monoclonal antibody, clone OTI1F1 (formerly 1F1)
Applications | FC, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) GBA3 mouse monoclonal antibody, clone OTI4C7 (formerly 4C7)
Applications | FC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) GBA3 mouse monoclonal antibody, clone OTI1C7 (formerly 1C7)
Applications | FC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) GBA3 mouse monoclonal antibody, clone OTI5G3 (formerly 5G3)
Applications | FC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) GBA3 mouse monoclonal antibody, clone OTI4F10 (formerly 4F10)
Applications | FC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) SHMT2 mouse monoclonal antibody, clone OTI3B3 (formerly 3B3)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) SHMT2 mouse monoclonal antibody,clone OTI1E12
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) SHMT2 mouse monoclonal antibody,clone OTI1E6
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) SHMT2 mouse monoclonal antibody, clone OTI3E9 (formerly 3E9)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) SHMT2 mouse monoclonal antibody, clone OTI1C1 (formerly 1C1)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) SHMT2 mouse monoclonal antibody,clone OTI5H10
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Rabbit Polyclonal Anti-GGT1 Antibody
Applications | IHC, WB |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human GGT1 |
SHMT1 Antibody
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen is a synthetic peptide directed towards the following sequence LVDLRSKGTDGGRAEKVLEACSIACNKNTCPGDRSALRPSGLRLGTPALT |
GBA3 mouse monoclonal antibody, clone OTI3E8 (formerly 3E8)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
GBA3 mouse monoclonal antibody, clone OTI3E8 (formerly 3E8), Biotinylated
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Biotin |
GBA3 mouse monoclonal antibody, clone OTI3E8 (formerly 3E8), HRP conjugated
Applications | IHC, WB |
Reactivities | Human |
Conjugation | HRP |
GBA3 mouse monoclonal antibody, clone OTI3E8 (formerly 3E8)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
GBA3 mouse monoclonal antibody, clone OTI5G5 (formerly 5G5)
Applications | FC, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
GBA3 mouse monoclonal antibody, clone OTI5G5 (formerly 5G5), Biotinylated
Applications | FC, IHC, WB |
Reactivities | Human |
Conjugation | Biotin |
GBA3 mouse monoclonal antibody, clone OTI5G5 (formerly 5G5), HRP conjugated
Applications | FC, IHC, WB |
Reactivities | Human |
Conjugation | HRP |
GBA3 mouse monoclonal antibody, clone OTI5G5 (formerly 5G5)
Applications | FC, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
GBA3 mouse monoclonal antibody, clone OTI4G8 (formerly 4G8)
Applications | FC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
GBA3 mouse monoclonal antibody, clone OTI4G8 (formerly 4G8), Biotinylated
Applications | FC, WB |
Reactivities | Human |
Conjugation | Biotin |
GBA3 mouse monoclonal antibody, clone OTI4G8 (formerly 4G8), HRP conjugated
Applications | FC, WB |
Reactivities | Human |
Conjugation | HRP |
GBA3 mouse monoclonal antibody, clone OTI4G8 (formerly 4G8)
Applications | FC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
GBA3 mouse monoclonal antibody, clone OTI1F1 (formerly 1F1)
Applications | FC, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
GBA3 mouse monoclonal antibody, clone OTI1F1 (formerly 1F1), Biotinylated
Applications | FC, IHC, WB |
Reactivities | Human |
Conjugation | Biotin |
GBA3 mouse monoclonal antibody, clone OTI1F1 (formerly 1F1), HRP conjugated
Applications | FC, IHC, WB |
Reactivities | Human |
Conjugation | HRP |
GBA3 mouse monoclonal antibody, clone OTI1F1 (formerly 1F1)
Applications | FC, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
GBA3 mouse monoclonal antibody, clone OTI4C7 (formerly 4C7)
Applications | FC, WB |
Reactivities | Human |
Conjugation | Unconjugated |