Rabbit Polyclonal Anti-AGXT2L1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-AGXT2L1 antibody: synthetic peptide directed towards the middle region of human AGXT2L1. Synthetic peptide located within the following region: KRVLLSADGPHRNVLKIKPPMCFTEEDAKFMVDQLDRILTVLEEAMGTKT |
ETNPPL Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human AGXT2L1 |
ETNPPL Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human AGXT2L1 |
Germany
Japan
United Kingdom
China