PUS1 (C-term) rabbit polyclonal antibody, Aff - Purified
Applications | IHC, WB |
Reactivities | Human |
Immunogen | KLH conjugated synthetic peptide between 329-358 amino acids from the C-terminal region of Human PUS1 |
PUS1 (C-term) rabbit polyclonal antibody, Aff - Purified
Applications | IHC, WB |
Reactivities | Human |
Immunogen | KLH conjugated synthetic peptide between 329-358 amino acids from the C-terminal region of Human PUS1 |
Rabbit Polyclonal Anti-Pus1 Antibody
Applications | WB |
Reactivities | Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-Pus1 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: GGWVWEETEHPAKRVKGGEDEEPPRKLPKRKIVLLMAYSGKGYHGMQRNL |
Rabbit Polyclonal Anti-PUS1 Antibody
Applications | WB |
Reactivities | Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-PUS1 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: PTIVSTERDERSMAQWLNTLPIHNFSGTALGAADTGAKVPSSLEGSEGDG |
PUS1 Antibody - N-terminal region
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
PUS1 Rabbit polyclonal Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 308-427 of human PUS1 (NP_079491.2). |
Modifications | Unmodified |