Rabbit polyclonal anti-HTR3D antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from N-terminalof human HTR3D. |
Rabbit polyclonal anti-HTR3D antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from N-terminalof human HTR3D. |
Anti-GABRB1 Rabbit Polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Peptide sequence around aa.432~436 (R-A-S-Q-L) derived from Human GABRB1. |
Anti-Gabra3 Rabbit Polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Peptide sequence around aa. 33~37(R-R-Q-E-P)derived from Rat GABA A Receptor a3. |
Rabbit Polyclonal anti-GABRB1 antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-GABRB1 antibody: synthetic peptide directed towards the middle region of human GABRB1. Synthetic peptide located within the following region: VDYKMVSKKVEFTTGAYPRLSLSFRLKRNIGYFILQTYMPSTLITILSWV |
Rabbit Polyclonal anti-GABRB3 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-GABRB3 antibody is: synthetic peptide directed towards the middle region of Human GABRB3. Synthetic peptide located within the following region: DIEFYWRGGDKAVTGVERIELPQFSIVEHRLVSRNVVFATGAYPRLSLSF |
Rabbit Polyclonal anti-GABRR1 antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-GABRR1 antibody: synthetic peptide directed towards the N terminal of human GABRR1. Synthetic peptide located within the following region: MLAVPNMRFGIFLLWWGWVLATESRMHWPGREVHEMSKKGRPQRQRREVH |
Rabbit Polyclonal Anti-CHRNA2 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-CHRNA2 antibody: synthetic peptide directed towards the N terminal of human CHRNA2. Synthetic peptide located within the following region: TKLSLWWLLLTPAGGEEAKRPPPRAPGDPLSSPSPTALPQGGSHTETEDR |
Rabbit Polyclonal Anti-GLRA1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-GLRA1 antibody: synthetic peptide directed towards the middle region of human GLRA1. Synthetic peptide located within the following region: TMNDLIFEWQEQGAVQVADGLTLPQFILKEEKDLRYCTKHYNTGKFTCIE |
Rabbit Polyclonal Anti-CHRNA3 Antibody
Applications | WB |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-CHRNA3 antibody: synthetic peptide directed towards the N terminal of human CHRNA3. Synthetic peptide located within the following region: LPVARASEAEHRLFERLFEDYNEIIRPVANVSDPVIIHFEVSMSQLVKVD |
USD 375.00
5 Days
Rabbit Polyclonal Anti-CHRNA4 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-CHRNA4 antibody: synthetic peptide directed towards the N terminal of human CHRNA4. Synthetic peptide located within the following region: ELGGPGAPRLLPPLLLLLGTGLLRASSHVETRAHAEERLLKKLFSGYNKW |
USD 310.00
5 Days
Rabbit Polyclonal Anti-CHRNA7 Antibody
Applications | WB |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-CHRNA7 antibody: synthetic peptide directed towards the N terminal of human CHRNA7. Synthetic peptide located within the following region: QGEFQRKLYKELVKNYNPLERPVANDSQPLTVYFSLSLLQIMDVDEKNQV |
USD 375.00
5 Days
Rabbit Polyclonal Anti-CHRNB2 Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-CHRNB2 antibody: synthetic peptide directed towards the N terminal of human CHRNB2. Synthetic peptide located within the following region: SGVWGTDTEERLVEHLLDPSRYNKLIRPATNGSELVTVQLMVSLAQLISV |
USD 310.00
5 Days
Rabbit Polyclonal Anti-CHRNB2 Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-CHRNB2 antibody: synthetic peptide directed towards the N terminal of human CHRNB2. Synthetic peptide located within the following region: SGVWGTDTEERLVEHLLDPSRYNKLIRPATNGSELVTVQLMVSLAQLISV |
Rabbit Polyclonal Anti-CHRNB3 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-CHRNB3 antibody: synthetic peptide directed towards the middle region of human CHRNB3. Synthetic peptide located within the following region: YDGTMVDLILINENVDRKDFFDNGEWEILNAKGMKGNRRDGVYSYPFITY |
Rabbit Polyclonal Anti-CHRND Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-CHRND antibody: synthetic peptide directed towards the N terminal of human CHRND. Synthetic peptide located within the following region: LTLGLLAALAVCGSWGLNEEERLIRHLFQEKGYNKELRPVAHKEESVDVA |
Rabbit Polyclonal Anti-CHRNA3 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-CHRNA3 antibody: synthetic peptide directed towards the N terminal of human CHRNA3. Synthetic peptide located within the following region: QEERLLADLMQNYDPNLRPAERDSDVVNVSLKLTLTNLISLNEREEALTT |
Rabbit Polyclonal Anti-GABRA2 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-GABRA2 antibody: synthetic peptide directed towards the middle region of human GABRA2. Synthetic peptide located within the following region: PMDAHSCPLKFGSYAYTTSEVTYIWTYNASDSVQVAPDGSRLNQYDLLGQ |
Rabbit Polyclonal Anti-GABRA3 Antibody
Applications | IHC |
Reactivities | Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-GABRA3 antibody: synthetic peptide directed towards the N terminal of human GABRA3. Synthetic peptide located within the following region: GTTGQGESRRQEPGDFVKQDIGGLSPKHAPDIPDDSTDNITIFTRILDRL |
Rabbit Polyclonal Anti-GABRD Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-GABRD antibody: synthetic peptide directed towards the N terminal of human GABRD. Synthetic peptide located within the following region: MDAPARLLAPLLLLCAQQLRGTRAMNDIGDYVGSNLEISWLPNLDGLIAG |
Rabbit Polyclonal Anti-GABRG2 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-GABRG2 antibody: synthetic peptide directed towards the N terminal of human GABRG2. Synthetic peptide located within the following region: GFTSQKSDDDYEDYASNKTWVLTPKVPEGDVTVILNNLLEGYDNKLRPDI |
Rabbit Polyclonal Anti-GABRP Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-GABRP antibody: synthetic peptide directed towards the N terminal of human GABRP. Synthetic peptide located within the following region: VEVGRSDKLSLPGFENLTAGYNKFLRPNFGGEPVQIALTLDIASISSISE |
USD 310.00
5 Days
Rabbit polyclonal Anti-CHRNB2 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-CHRNB2 antibody: synthetic peptide directed towards the middle region of human CHRNB2. Synthetic peptide located within the following region: KIEVKHFPFDQQNCTMKFRSWTYDRTEIDLVLKSEVASLDDFTPSGEWDI |
Rabbit Polyclonal Anti-CHRNA5 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-CHRNA5 antibody: synthetic peptide directed towards the middle region of human CHRNA5. Synthetic peptide located within the following region: PDIVLFDNADGRFEGTSTKTVIRYNGTVTWTPPANYKSSCTIDVTFFPFD |
Rabbit Polyclonal Anti-CHRNA5 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-CHRNA5 antibody: synthetic peptide directed towards the middle region of human CHRNA5. Synthetic peptide located within the following region: DGSQVDIILEDQDVDKRDFFDNGEWEIVSATGSKGNRTDSCCWYPYVTYS |
USD 375.00
5 Days
Rabbit Polyclonal Anti-CHRNA4 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-CHRNA4 antibody: synthetic peptide directed towards the N terminal of human CHRNA4. Synthetic peptide located within the following region: AEERLLKKLFSGYNKWSRPVANISDVVLVRFGLSIAQLIDVDEKNQMMTT |
Rabbit Polyclonal Anti-CHRNA3 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-CHRNA3 antibody: synthetic peptide directed towards the N terminal of human CHRNA3. Synthetic peptide located within the following region: EHRLFERLFEDYNEIIRPVANVSDPVIIHFEVSMSQLVKVDEVNQIMETN |
Rabbit Polyclonal Anti-CHRNA1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-CHRNA1 antibody: synthetic peptide directed towards the N terminal of human CHRNA1. Synthetic peptide located within the following region: TRLVAKLFKDYSSVVRPVEDHRQVVEVTVGLQLIQLINVDEVNQIVTTNV |
Rabbit Polyclonal Anti-CHRNA1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-CHRNA1 antibody: synthetic peptide directed towards the N terminal of human CHRNA1. Synthetic peptide located within the following region: AGLVLGSEHETRLVAKLFKDYSSVVRPVEDHRQVVEVTVGLQLIQLINVD |
Rabbit Polyclonal Anti-CHRND Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-CHRND antibody: synthetic peptide directed towards the N terminal of human CHRND. Synthetic peptide located within the following region: RLIRHLFQEKGYNKELRPVAHKEESVDVALALTLSNLISLKEVEETLTTN |
Rabbit Polyclonal Anti-GABRA1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-GABRA1 antibody: synthetic peptide directed towards the N terminal of human GABRA1. Synthetic peptide located within the following region: WAWILLLSTLTGRSYGQPSLQDELKDNTTVFTRILDRLLDGYDNRLRPGL |
Rabbit Polyclonal Anti-GABRA1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-GABRA1 antibody: synthetic peptide directed towards the middle region of human GABRA1. Synthetic peptide located within the following region: YDLLGQTVDSGIVQSSTGEYVVMTTHFHLKRKIGYFVIQTYLPCIMTVIL |
Rabbit Polyclonal Anti-Gabra3 Antibody
Applications | WB |
Reactivities | Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-Gabra3 antibody is: synthetic peptide directed towards the N-terminal region of Rat Gabra3. Synthetic peptide located within the following region: LLISILPGTTGQGESRRQEPGDFVKQDIGGLSPKHAPDIPDDSTDNITIF |
Rabbit Polyclonal Anti-GABRA4 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-GABRA4 antibody: synthetic peptide directed towards the N terminal of human GABRA4. Synthetic peptide located within the following region: MVSAKKVPAIALSAGVSFALLRFLCLAVCLNESPGQNQKEEKLCTENFTR |
Rabbit Polyclonal Anti-GABRA5 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-GABRA5 antibody: synthetic peptide directed towards the middle region of human GABRA5. Synthetic peptide located within the following region: AKIKKKREVILNKSTNAFTTGKMSHPPNIPKEQTPAGTSNTTSVSVKPSE |
Rabbit Polyclonal Anti-GABRB2 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-GABRB2 antibody: synthetic peptide directed towards the N terminal of human GABRB2. Synthetic peptide located within the following region: DNRVADQLWVPDTYFLNDKKSFVHGVTVKNRMIRLHPDGTVLYGLRITTT |
Rabbit Polyclonal Anti-GABRB2 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-GABRB2 antibody: synthetic peptide directed towards the N terminal of human GABRB2. Synthetic peptide located within the following region: HPDGTVLYGLRITTTAACMMDLRRYPLDEQNCTLEIESYGYTTDDIEFYW |
Rabbit Polyclonal Anti-GABRR1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-GABRR1 antibody: synthetic peptide directed towards the N terminal of human GABRR1. Synthetic peptide located within the following region: EMSKKGRPQRQRREVHEDAHKQVSPILRRSPDITKSPLTKSEQLLRIDDH |
Rabbit Polyclonal Anti-GABRR2 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-GABRR2 antibody: synthetic peptide directed towards the middle region of human GABRR2. Synthetic peptide located within the following region: SNKSMTFDGRLVKKIWVPDVFFVHSKRSFTHDTTTDNIMLRVFPDGHVLY |
Rabbit Polyclonal Anti-GABRE Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-GABRE antibody: synthetic peptide directed towards the N terminal of human GABRE. Synthetic peptide located within the following region: DVVYGPQPQPLENQLLSEETKSTETETGSRVGKLPEASRILNTILSNYDH |
Rabbit Polyclonal Anti-GABRQ Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-GABRQ antibody: synthetic peptide directed towards the N terminal of human GABRQ. Synthetic peptide located within the following region: KFHFEFSSAVPEVVLNLFNCKNCANEAVVQKILDRVLSRYDVRLRPNFGG |
Rabbit Polyclonal Anti-GABRB2 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-GABRB2 antibody: synthetic peptide directed towards the N terminal of human GABRB2. Synthetic peptide located within the following region: MWRVRKRGYFGIWSFPLIIAAVCAQSVNDPSNMSLVKETVDRLLKGYDIR |
Rabbit Polyclonal Anti-GABRB3 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-GABRB3 antibody: synthetic peptide directed towards the middle region of human GABRB3. Synthetic peptide located within the following region: ESYGYTTDDIEFYWRGGDKAVTGVERIELPQFSIVEHRLVSRNVVFATGA |
Rabbit Polyclonal Anti-GABRE Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-GABRE antibody: synthetic peptide directed towards the middle region of human GABRE. Synthetic peptide located within the following region: KNSWKLFQFDFTGVSNKTEIITTPVGDFMVMTIFFNVSRRFGYVAFQNYV |
Rabbit Polyclonal Anti-HTR3C Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-HTR3C antibody: synthetic peptide directed towards the middle region of human HTR3C. Synthetic peptide located within the following region: CCPTAPQKGNKGLGLTLTHLPGPKEPGELAGKKLGPRETEPDGGSGWTKT |
Rabbit Polyclonal Anti-GABRG2 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-GABRG2 antibody: synthetic peptide directed towards the C terminal of human GABRG2. Synthetic peptide located within the following region: AMDLFVSVCFIFVFSALVEYGTLHYFVSNRKPSKDKDKKKKNPAPTIDIR |
Rabbit Polyclonal Anti-Htr3a Antibody
Applications | WB |
Reactivities | Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-Htr3a antibody: synthetic peptide corresponding to a region of Rat. Synthetic peptide located within the following region: PATAIGTPLIGVYFVVCMALLVISLAETIFIVQLVHKQDLQRPVPDWLRH |
Anti-GLRA1/GLRA2/GLRA3 Rabbit Polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 219-233 amino acids of Human glycine receptor, alpha 1 |
Anti-GLRA1 Rabbit Polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 141-155 amino acids of human glycine receptor, alpha 1 |
Anti-GLRA1 Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 141-155 amino acids of human glycine receptor, alpha 1 |
Anti-CHRNA3 Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 69-83 amino acids of Human cholinergic receptor, nicotinic, alpha 3 (neuronal) |