GPC4 rabbit polyclonal antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human GPC4 |
GPC4 rabbit polyclonal antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human GPC4 |
GPC4 Rabbit Polyclonal (N-Terminus) Antibody
Applications | IHC |
Reactivities | Gibbon, Dog, Gorilla, Hamster, Human, Pig |
Conjugation | Unconjugated |
Immunogen | GPC4 / Glypican 4 antibody was raised against synthetic 16 amino acid peptide from N-Terminus of human GPC4 / Glypican 4. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Hamster, Panda, Dog, Pig (100%); Marmoset, Mouse, Elephant, Bovine, Horse (94%); Rat, Bat, Rabbit (88%). |
GPC4 Rabbit Polyclonal (Internal) Antibody
Applications | IHC |
Reactivities | Bat, Gibbon, Gorilla, Hamster, Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | GPC4 / Glypican 4 antibody was raised against synthetic 16 amino acid peptide from internal region of human GPC4 / Glypican 4. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Mouse, Rat, Bat, Hamster (100%); Marmoset, Dog, Elephant, Panda, Rabbit (94%); Bovine, Horse, Pig (88%). |
GPC4 Rabbit Polyclonal (C-Terminus) Antibody
Applications | IHC |
Reactivities | Gorilla, Human |
Conjugation | Unconjugated |
Immunogen | GPC4 / Glypican 4 antibody was raised against synthetic 16 amino acid peptide from C-terminus of human GPC4 / Glypican 4. Percent identity with other species by BLAST analysis: Human, Gorilla, Monkey (100%); Gibbon, Marmoset, Rabbit (94%); Mouse, Rat, Bovine, Panda (88%); Hamster, Horse (81%). |
Rabbit Polyclonal Anti-GPC4 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-GPC4 antibody is: synthetic peptide directed towards the C-terminal region of Human GPC4. Synthetic peptide located within the following region: EYQQCPSEFDYNATDHAGKSANEKADSAGVRPGAQAYLLTVFCILFLVMQ |
GPC4 rabbit polyclonal antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human GPC4 |
GPC4 Rabbit polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 357-556 of human GPC4 (NP_001439.2). |
Modifications | Unmodified |