Chicken Polyclonal ENC-2 Antibody
Applications | IF, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | ENC-2 antibody was raised against a 14 amino acid peptide near the center of human ENC-2. |
Chicken Polyclonal ENC-2 Antibody
Applications | IF, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | ENC-2 antibody was raised against a 14 amino acid peptide near the center of human ENC-2. |
Rabbit Polyclonal Anti-KLHL25 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-KLHL25 antibody: synthetic peptide directed towards the N terminal of human KLHL25. Synthetic peptide located within the following region: RLYEFSWRMCLVHFETVRQSEDFNSLSKDTLLDLISSDELETEDERVVFE |
Rabbit Polyclonal Anti-KLHL25 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-KLHL25 Antibody: synthetic peptide directed towards the N terminal of human KLHL25. Synthetic peptide located within the following region: SRYFEAMFSHGLRESRDDTVNFQDNLHPEVLELLLDFAYSSRIAINEENA |
Rabbit Polyclonal Anti-KLHL25 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-KLHL25 antibody: synthetic peptide directed towards the N terminal of human KLHL25. Synthetic peptide located within the following region: LFPSNCLGMMLLSDAHQCRRLYEFSWRMCLVHFETVRQSEDFNSLSKDTL |