Rabbit Polyclonal Anti-PIAS4 Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-PIAS4 Antibody: A synthesized peptide derived from human PIAS4 |
Rabbit Polyclonal Anti-PIAS4 Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-PIAS4 Antibody: A synthesized peptide derived from human PIAS4 |
Rabbit polyclonal anti-PIAS4 antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from Internal of human PIAS4. |
Rabbit Polyclonal PIAS4 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | PIAS4 antibody was raised against a 19 amino acid synthetic peptide near the amino terminus of human PIAS4. |
Rabbit Polyclonal Anti-PIAS4 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-PIAS4 Antibody: synthetic peptide directed towards the N terminal of human PIAS4. Synthetic peptide located within the following region: AKNMVMSFRVSDLQMLLGFVGRSKSGLKHELVTRALQLVQFDCSPELFKK |