Antibodies

View as table Download

CYP7B1 rabbit polyclonal antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide of human CYP7B1

Rabbit polyclonal Cytochrome P450 7B1 antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human Cytochrome P450 7B1.

CYP7B1 rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human

CYP7B1 (C-term) goat polyclonal antibody, Aff - Purified

Applications ELISA, IHC
Reactivities Bovine, Human
Immunogen Peptide with sequence C-YPDSDVLFRYKVKS, from the C Terminus of the protein sequence according to NP_004811.1.

Rabbit Polyclonal Anti-CYP7B1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CYP7B1 antibody: synthetic peptide directed towards the C terminal of human CYP7B1. Synthetic peptide located within the following region: AMYYLLRHPEAMAAVRDEIDRLLQSTGQKKGSGFPIHLTREQLDSLICLE

CYP7B1 rabbit polyclonal antibody

Applications WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide selected from the Center region of human CYP7B1

CYP7B1 rabbit polyclonal antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide of human CYP7B1

CYP7B1 Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide corresponding to a sequence within amino acids 200-300 of human CYP7B1 (NP_004811.1).
Modifications Unmodified