Antibodies

View as table Download

ARHGDIB rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human ARHGDIB

Goat Anti-ARHGDIB Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence TEKAPEPHVE-C, from the N Terminus of the protein sequence according to NP_001166.3.

Rabbit Polyclonal Anti-ARHGDIB Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ARHGDIB antibody is: synthetic peptide directed towards the N-terminal region of Human ARHGDIB. Synthetic peptide located within the following region: MTEKAPEPHVEEDDDDELDSKLNYKPPPQKSLKELQEMDKDDESLIKYKK

ARHGDIB rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human ARHGDIB

ARHGDIB Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-201 of human ARHGDIB (NP_001166.3).
Modifications Unmodified