Rabbit Polyclonal Wnt10b Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Wnt10b antibody was raised against a 15 amino acid peptide from near the center of human Wnt10b. |
Rabbit Polyclonal Wnt10b Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Wnt10b antibody was raised against a 15 amino acid peptide from near the center of human Wnt10b. |
Rabbit Polyclonal Anti-WNT10B Antibody
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-WNT10B antibody: synthetic peptide directed towards the middle region of human WNT10B. Synthetic peptide located within the following region: GTSGSCQFKTCWRAAPEFRAVGAALRERLGRAIFIDTHNRNSGAFQPRLR |
Rabbit polyclonal WNT10B Antibody (Center)
Applications | FC, IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | This WNT10B antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 193-222 amino acids from the Central region of human WNT10B. |
Rabbit Polyclonal Anti-WNT10B Antibody (Internal)
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | WNT10B antibody was raised against synthetic 16 amino acid peptide from internal region of human WNT10B. Percent identity with other species by BLAST analysis: Human, Gorilla, Orangutan, Monkey, Marmoset, Mouse, Rat, Elephant, Dog, Bat, Horse, Rabbit, Pig (100%); Hamster (94%); Panda (88%). |
Rabbit Polyclonal Anti-WNT10B Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human WNT10B |