Rabbit polyclonal anti-PDE3B antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide surrounding amino acid 948 of mouse PDE3B. |
Rabbit polyclonal anti-PDE3B antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide surrounding amino acid 948 of mouse PDE3B. |
Rabbit Polyclonal Anti-PDE3B Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-PDE3B antibody: synthetic peptide directed towards the middle region of human PDE3B. Synthetic peptide located within the following region: SRPEYNFLLHLDHVEFKRFRFLVIEAILATDLKKHFDFLAEFNAKANDVN |
Carrier-free (BSA/glycerol-free) PDE3B mouse monoclonal antibody,clone OTI3F5
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
PDE3B mouse monoclonal antibody,clone OTI3F5
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
PDE3B mouse monoclonal antibody,clone OTI3F5
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |