Antibodies

View as table Download

Rabbit polyclonal antibody to PLA2G3 (phospholipase A2, group III)

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 263 and 502 of PLA2G3 (Uniprot ID#Q9NZ20)

PLA2G3 Rabbit Polyclonal (Internal) Antibody

Applications IHC
Reactivities Gibbon, Bovine, Gorilla, Human, Monkey, Pig
Conjugation Unconjugated
Immunogen PLA2G3 antibody was raised against synthetic 12 amino acid peptide from internal region of human PLA2G3. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Marmoset, Bovine, Elephant, Panda, Pig (100%); Mouse, Horse, Rabbit (92%); Bat, Dog, Opossum (83%).

Rabbit Polyclonal Anti-PLA2G3 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PLA2G3 antibody is: synthetic peptide directed towards the C-terminal region of Human PLA2G3. Synthetic peptide located within the following region: QRRHQLQDKGTDERQPWPSEPLRGPMSFYNQCLQLTQAARRPDRQQKSWS

Carrier-free (BSA/glycerol-free) PLA2G3 mouse monoclonal antibody,clone OTI1F4

Applications WB
Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) PLA2G3 mouse monoclonal antibody,clone OTI4F2

Applications WB
Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) PLA2G3 mouse monoclonal antibody,clone OTI8G8

Applications WB
Reactivities Human
Conjugation Unconjugated

PLA2G3 Antibody - C-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the C terminal region of human PLA2G3

PLA2G3 Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen A synthetic peptide of Human PLA2G3.
Modifications Unmodified

PLA2G3 mouse monoclonal antibody,clone OTI1F4

Applications WB
Reactivities Human
Conjugation Unconjugated

PLA2G3 mouse monoclonal antibody,clone OTI1F4

Applications WB
Reactivities Human
Conjugation Unconjugated

PLA2G3 mouse monoclonal antibody,clone OTI4F2

Applications WB
Reactivities Human
Conjugation Unconjugated

PLA2G3 mouse monoclonal antibody,clone OTI4F2

Applications WB
Reactivities Human
Conjugation Unconjugated

PLA2G3 mouse monoclonal antibody,clone OTI8G8

Applications WB
Reactivities Human
Conjugation Unconjugated

PLA2G3 mouse monoclonal antibody,clone OTI8G8

Applications WB
Reactivities Human
Conjugation Unconjugated